Back to Home / #debian / 2007 / 07 / Prev Day | Next Day
#debian IRC Logs for 2007-07-23

---Logopened Mon Jul 23 00:00:28 2007
---Daychanged Mon Jul 23 2007
00:00|-|Tombar [~tombar@r190-64-3-74.dialup.adsl.anteldata.net.uy] has joined #debian
00:02|-|Guest41 [~knoppix@200.55.143.197] has quit [Remote host closed the connection]
00:03|-|bathat [~bathat_@c-71-206-106-117.hsd1.mi.comcast.net] has quit [Quit: Leaving]
00:06<mic>does anyone know about setting up mysql?
00:06|-|GNUdog [~drivel@222.85.119.26] has left #debian [Leaving]
00:07<chealer>mic: quite certainly. just ask your question.
00:09<mic>chealer look in private chat
00:09|-|king_crimson [~family@71-14-80-91.dhcp.stls.mo.charter.com] has quit [Quit: BitchX: born to raise hell]
00:09<chealer>mic: I don't answer to private messages unless you ask for permission first. ask your questions in the channel.
00:10<mic>ok sorry
00:10<mic>i need help setting up mysql
00:10<mic>im totally new to linux, only just installed apache2 and php4
00:11<chealer>mic: just ask your question.
00:12<mic>can you tell me exactly how to setup mysql?
00:12|-|jm_ [flier@mindwipe.org] has joined #debian
00:14<chealer>mic: setup how? to work with php4?
00:14<mic>yes
00:14<chealer>mic: if you don't mind, is there a reason why you use php4 rather than php5?
00:15<mic>chealer: im more used to it, personal preference i guess
00:16<chealer>mic: OK. I'm not sure if you need to do anything. Did you try to use your application without doing any MySQL configuration?
00:17<mic>i need a database for some scripts that i host
00:17<chealer>mic: yeah, so did you try to run your scripts without doing any MySQL configuration?
00:18<mic>no, i dont think so
00:20<mic>i am new to linux, what i need is to store tables and data in a mysql database
00:20<chealer>mic: could you do that easily? because at least with php5 I think you don't need any configuration.
00:21<mic>is there a way to copy files from my windows pc, to the linux pc?
00:21<chealer>mic: yes. which desktop environment do you use?
00:22<mic>on linux? im commant line
00:22<mic>command*
00:23<chealer>mic: yes. OK
00:24<chealer>mic: you can either download a file with smbget, or mount a SMB share with smbmount
00:24|-|blaheva [~blaheva@tor-irc.dnsbl.oftc.net] has joined #debian
00:24<chealer>sorry, mount, not smbmount
00:25|-|tcsetattr [pacman@dialup-4.252.235.72.Dial1.Cincinnati1.Level3.net] has joined #debian
00:25<mic>how do you do that?
00:25<mic>im a total linux noob
00:25<jm_>using smbmount is much easier since it doesn't require being run as root or fstab editing
00:27<mic>how do i do that?
00:27<jm_>man smbmount
00:27<mic>syntax?
00:28|-|lymeca_ [~lymeca@tor-irc.dnsbl.oftc.net] has quit [Ping timeout: 480 seconds]
00:30|-|lymeca_ [~lymeca@tor-irc.dnsbl.oftc.net] has joined #debian
00:34|-|hidox [~hidox@200.113.147.205] has joined #debian
00:36<hidox>hola
00:37<hidox>How I know my ubuntu version ???
00:37|-|arato [~arato@S01060018f857ee67.ed.shawcable.net] has joined #debian
00:38<chealer>hidox: this is a Debian support channel.
00:38<mic>hidox join #ubuntu
00:38<hidox>ok ,you dont know how to do that !!
00:40|-|aespinoza [~aespinoza@ip68-5-90-137.oc.oc.cox.net] has joined #debian
00:40<mic>this is a debian support chat not unbutu
00:41<chealer>hidox: it's not necessarily that we don't know, it's just offtopic here.
00:43|-|Web-sidux715 [~bb@dslb-088-072-208-079.pools.arcor-ip.net] has joined #debian
00:44<hidox>ok I clear , you dont know
00:44<hidox>only say it
00:44<hidox>I dont know it !
00:45<hidox>I will understand you !
00:45<hidox>dont worry
00:46|-|aespinoza [~aespinoza@ip68-5-90-137.oc.oc.cox.net] has quit [Quit: [BX] aespinoza has no reason... just kidding :)]
00:46|-|aespinoza [~aespinoza@ip68-5-90-137.oc.oc.cox.net] has joined #debian
00:46|-|aespinoza [~aespinoza@ip68-5-90-137.oc.oc.cox.net] has quit []
00:46|-|meandtheshell [~markus@85.127.114.21] has quit [Quit: Leaving.]
00:46|-|snowball_ [~snowball@nly93-1-82-232-72-199.fbx.proxad.net] has joined #debian
00:46|-|naudiz [naudiz@cpe-24-161-112-80.hvc.res.rr.com] has joined #debian
00:47|-|Sub-Zero [~Sub-Zero@190.38.177.24] has quit [Quit: sortadi :-)]
00:47|-|aespinoza [~aespinoza@ip68-5-90-137.oc.oc.cox.net] has joined #debian
00:47<naudiz>Does the default Debian Etch kernel have support for RTC time ?
00:47|-|aespinoza [~aespinoza@ip68-5-90-137.oc.oc.cox.net] has quit []
00:49<chealer>naudiz: uh, Linux 2.6.18 does support RTC-s.
00:49|-|tsai_ [~tsai@ip68-108-175-23.lv.lv.cox.net] has joined #debian
00:50<tsai_>anybody know about mythtv for debian etch?
00:51|-|meandtheshell [~markus@85.127.102.246] has joined #debian
00:52<naudiz>chealer hwclock clocks times out while trying to get my sysem time so my system time is never right and I can't use ntp because this is a laptop that is not always connected to the internet so I need my BIOS clock to be used
00:52<chealer>!tell tsai_ about mythtv
00:53<naudiz>/bin/sh: hwclock: command not found
00:53<naudiz>oops
00:53<naudiz> hwclock --hctosys
00:54<naudiz>select() to /dev/rtc to wait for clock tick timed out
00:54<naudiz>s/sysem/system/g
00:55<naudiz>chealer: maybe my BIOS clock is not supported ?
00:55|-|limcore [~limcore@tor-irc.dnsbl.oftc.net] has joined #debian
00:55<tsai_>where is the pastebin for this chat room located? want to post some errors
00:56|-|sangeetha [~sangeetha@203.129.255.190] has joined #debian
00:56<chealer>!tell tsai_ about paste
00:57<chealer>naudiz: no idea. Google may be helpful.
00:58|-|faw [~felipe@faw.user.oftc.net] has quit [Quit: Leaving]
00:58<jm_>Debian kernels have RTC support enabled, at least for 686 kernel (as module)
00:59|-|mode/#debian [+l 278] by debhelper
00:59|-|cmot [~avbidder@62-2-219-110.static.cablecom.ch] has quit [Remote host closed the connection]
01:01|-|niru [~niru@203.129.255.178] has joined #debian
01:03<tsai_>i'm using debian etch 4.0 and trying to install mythtv. When I do mythfilldatabase i get: www.tsairox.com/mysqler.txt Any idea as to what I should do>
01:03<hidox><hidox> algun chucha de su madre sabe esta huevada o no ??
01:06<jm_>!es
01:06<dpkg>Hispanohablantes: Por favor usen #debian-es, alli obtendran mas ayuda. Spanish Speakers: Please use #debian-es, there you will get much more help.
01:09<djuLoq>hidox, ante que te cases miro lo que haces; este canal es por profesonales gracias
01:10|-|limcore [~limcore@tor-irc.dnsbl.oftc.net] has left #debian []
01:13<naudiz>chealer: yep I found the fix on google
01:14|-|clemux [clemux@alanine.quarante-d.eu] has quit [Remote host closed the connection]
01:15<hidox>habla bien primero culiado
01:16<hidox>aprende español
01:16|-|sep [~sep@40.211.jostedal.no] has joined #debian
01:17|-|nou [Chaton@causse.larzac.fr.eu.org] has quit [Ping timeout: 480 seconds]
01:18<chealer>hidox: unless you have something to write about Debian in English, be quiet.
01:20|-|hidox [~hidox@200.113.147.205] has quit [Remote host closed the connection]
01:20|-|ukine-server [~ukine@67-70.200-68.tampabay.res.rr.com] has joined #debian
01:20|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has quit [Quit: Leaving]
01:22|-|edge_master [~andres@r190-64-105-132.dialup.adsl.anteldata.net.uy] has joined #debian
01:24|-|klMo [~mo@e178195154.adsl.alicedsl.de] has quit [Remote host closed the connection]
01:25|-|snowball_ [~snowball@nly93-1-82-232-72-199.fbx.proxad.net] has quit [Remote host closed the connection]
01:27|-|edge_master [~andres@r190-64-105-132.dialup.adsl.anteldata.net.uy] has quit []
01:28|-|loserbar [~loop@user-12lct4t.cable.mindspring.com] has joined #debian
01:28|-|loserbar [~loop@user-12lct4t.cable.mindspring.com] has quit []
01:28|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has joined #debian
01:28|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has left #debian []
01:29|-|loserbar [~loop@user-12lct4t.cable.mindspring.com] has joined #debian
01:31|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has joined #debian
01:31|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has left #debian []
01:31|-|_spOOn_ [~adam@219-90-201-165.static.adam.com.au] has quit [Quit: Leaving]
01:32<loserbar>hey does anyone know how long debian-unofficial has been down?
01:33|-|die_z [~die_z@ip-115-150.adsl.cheapnet.it] has joined #debian
01:33<mic>can anyone help with a php problem?
01:37|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
01:38|-|naudiz [naudiz@cpe-24-161-112-80.hvc.res.rr.com] has quit [Quit: Lost terminal]
01:41|-|ukine-server [~ukine@67-70.200-68.tampabay.res.rr.com] has quit [Ping timeout: 480 seconds]
01:42|-|madroach [madroach.d@p5B11C636.dip0.t-ipconnect.de] has joined #debian
01:42|-|arato [~arato@S01060018f857ee67.ed.shawcable.net] has quit [Quit: Leaving]
01:43|-|kintaro0e [~kintaro0e@cebu.exist.com] has quit [Quit: Leaving]
01:43|-|Le_Vert [~gandalf@81.56.128.63] has joined #debian
01:44|-|tralala_ changed nick to tralala
01:44|-|loserbar [~loop@user-12lct4t.cable.mindspring.com] has quit [Quit: Leaving]
01:45|-|_spOOn_ [~adam@219-90-201-165.static.adam.com.au] has joined #debian
01:46|-|tsai_ [~tsai@ip68-108-175-23.lv.lv.cox.net] has quit [Remote host closed the connection]
01:46<_spOOn_>Incompatible medium installed -- (asc=0x30, ascq=0x00)
01:46<_spOOn_>cant seem to use blank dvds
01:46<_spOOn_>any ideas?
01:47<Le_Vert>matshita ?
01:47|-|juancgt [~juancgt@c-76-17-127-141.hsd1.ga.comcast.net] has joined #debian
01:47<_spOOn_>MSI
01:47|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
01:48<_spOOn_>DVDR/RW +-
01:48|-|madroach [madroach.d@p5B11C636.dip0.t-ipconnect.de] has quit [Remote host closed the connection]
01:48|-|kintaro0e [~kintaro0e@cebu.exist.com] has joined #debian
01:49|-|mode/#debian [+l 272] by debhelper
01:50|-|ukine-server [~ukine@67-70.200-68.tampabay.res.rr.com] has joined #debian
01:53|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has joined #debian
01:53|-|Melais [~Melais@intranet.zonepro-network.net] has joined #debian
01:55|-|blarson [~blarson@64.81.35.59] has joined #debian
01:56|-|clemux [clemux@alanine.quarante-d.eu] has joined #debian
01:57|-|nou [Chaton@causse.larzac.fr.eu.org] has joined #debian
01:58|-|ewanm89 [~ewanm89@host81-159-254-36.range81-159.btcentralplus.com] has joined #debian
01:58|-|ewanm89 changed nick to ewanm89_laptop
01:59|-|mode/#debian [+l 279] by debhelper
02:03|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
02:04|-|dracozna [~dracozna@cc408686-b.leek1.gr.home.nl] has joined #debian
02:05|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has quit [Quit: Leaving]
02:10|-|Lohrun [~chatzilla@crock.sp2mi.univ-poitiers.fr] has joined #debian
02:12|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has joined #debian
02:14|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has joined #debian
02:14|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has left #debian []
02:16|-|streuner [~streuner@p54A5EC73.dip.t-dialin.net] has quit [Quit: Verlassend]
02:16<niru>I want to do net install for the cd image that i just create
02:16<niru>I have the codename as "pango" etc
02:19|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has joined #debian
02:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
02:19|-|madrescher [~hkunz@84-72-80-233.dclient.hispeed.ch] has left #debian []
02:20|-|ilan_ [ilan@69.60.110.251] has joined #debian
02:21|-|visik7 [~dksakd@aruba-122-211.aruba.unimo.it] has joined #debian
02:23|-|JoY [~JoY@85-18-71-186.ip.fastwebnet.it] has joined #debian
02:23|-|mytc02 [~mytc02@60.52.89.86] has joined #debian
02:23|-|mytc02 [~mytc02@60.52.89.86] has quit []
02:25|-|s0d0 [~john@host86-153-91-137.range86-153.btcentralplus.com] has joined #debian
02:25|-|ilan_ [ilan@69.60.110.251] has quit [Quit: leaving]
02:27|-|foolano [~magnetic@14.Red-88-26-177.staticIP.rima-tde.net] has joined #debian
02:31|-|lunatic [~francois@erlannic.irisa.fr] has joined #debian
02:32|-|Glenn^BF [~fburlet@user-85-201-4-202.tvcablenet.be] has joined #debian
02:33|-|burwaco [~burwaco@12.149-244-81.adsl-dyn.isp.belgacom.be] has joined #debian
02:33|-|torrr [~ofirg@bzq-88-154-34-92.red.bezeqint.net] has quit [Read error: Connection reset by peer]
02:33<burwaco>hello everyone
02:34|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
02:34|-|rickysarraf [~Rickyx@202.3.112.4] has joined #debian
02:39|-|mode/#debian [+l 288] by debhelper
02:39|-|Tiamat13 [Tiamat13@h168.134.40.162.ip.alltel.net] has joined #debian
02:40|-|Imposible_gUrL [~hudanetca@222.124.60.66] has joined #debian
02:40<Tiamat13>does anyone have the link where i can download rwwrtwin ...
02:41<Imposible_gUrL>oi
02:41|-|kmap [~kmap@barmen.interhost.no] has joined #debian
02:41<Tiamat13>sup Imposible_gUrL
02:42|-|Tiamat13 [Tiamat13@h168.134.40.162.ip.alltel.net] has quit []
02:46|-|tino [~tino@25.Red-83-57-70.dynamicIP.rima-tde.net] has joined #debian
02:47<tino>#guadali-es
02:47|-|tino [~tino@25.Red-83-57-70.dynamicIP.rima-tde.net] has quit []
02:48|-|debUsr42 [~sanctus@p54BA61AE.dip.t-dialin.net] has joined #debian
02:48|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
02:50|-|torrr [~ofirg@bzq-88-154-46-83.red.bezeqint.net] has joined #debian
02:52|-|kart_ [~kart_@59.182.53.137] has quit [Ping timeout: 480 seconds]
02:56|-|Eulex [~alex@85.235.5.10] has joined #debian
02:56|-|s0d0 [~john@host86-153-91-137.range86-153.btcentralplus.com] has quit [Remote host closed the connection]
02:58|-|thomasbl [~thomasbl@85.179.25.10] has joined #debian
02:58|-|zineey [~zineey@122.96.176.211] has joined #debian
02:59|-|zineey [~zineey@122.96.176.211] has quit []
03:01|-|tcsetattr [pacman@dialup-4.252.235.72.Dial1.Cincinnati1.Level3.net] has quit [Quit: tcsetattr]
03:03|-|kop [~kop@meme-net.meme.com] has quit [Ping timeout: 480 seconds]
03:03<burwaco>what the... how does this work ?
03:03|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
03:04|-|Belisarivs [~Belisariv@5.56.rychly-net.cz] has joined #debian
03:04<Belisarivs>hi all
03:04<Belisarivs>Is there someone experienced with usplash?
03:05|-|kart_ [~kart_@59.182.26.18] has joined #debian
03:05|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has joined #debian
03:06<kmap>Belisarivs: I am not a usplash expert, but wanted to know: why did you prefer it over bootsplash
03:06<Belisarivs>Because bootsplash requires patching of kernel
03:07<Belisarivs>I have no problem with it. I compile own, but I have to look for patches containing also ck patchset. Shame that Con ceased work on them.
03:07<kmap>Belisarivs: Agreed. But bootsplash also can beautify your ttys.
03:07<kmap>Belisarivs: . But, if you don't compile your kernel, usplash is probable the way to go
03:07<Belisarivs>I compile own, but I have to look for patches containing also ck patchset.
03:08<kmap>Belisarivs, OK
03:08<Belisarivs>Actually, i don't have to, but I'd like to.
03:08<kmap>Belisarivs: Why did he stop making the cks?
03:08<kmap>Belisarivs: OK, got the web page
03:09<Belisarivs>Because he got angry, that his work wasn't implemented and CFS actually reinvented wheel.
03:09<kmap>Belisarivs: OK
03:09<bcochofel>Hi, I'm trying to install php4-sybase but I'm getting an error because I have php4-common...+etch3 and I need php4-common...+etch1. How can I solve this?
03:10|-|varka [~varkatope@p54A5EF44.dip.t-dialin.net] has joined #debian
03:10|-|varka [~varkatope@p54A5EF44.dip.t-dialin.net] has quit [Remote host closed the connection]
03:10<bcochofel>I don't have nor php4-common...+etch1 nor php4-sybase...+etch3 on my list of debs
03:10<jm_>by making sure you're installing php4-sybase from s.d.o
03:10<bcochofel>jm_: Ok, how can I do that?
03:10<jm_>bcochofel: /msg dpkg security
03:11<bcochofel> /msg dpkg security
03:11|-|snaj [~chatzilla@dsl-out.exorigo.pl] has joined #debian
03:11<burwaco>hello all, I installed etch from a netcd on my laptop, after reboot I don't have wireless lan, does anyone know how to help me ?
03:12<kmap>burwaco, Depending on what card you have, you may need ndiswrapper
03:12<Belisarivs>BTW, it seems, that bootsplash de is hone.
03:12<burwaco>kmap, I have a Socket 0 Bridge: [yenta_cardbus] (bus ID: 0000:00:08.0)
03:12<burwaco>Socket 0 Device 0: [hostap_cs] (bus ID: 0.0)
03:13<burwaco>It's a pcmcia dlink card
03:13<kmap>burwaco, Could you somehow find the name?
03:13<kmap>burwaco, OK
03:13<burwaco>I did the netinstall with it, but after reboot I don't get dhcp offers anymore...
03:14<kmap>burwaco, Oh. What does /sbin/ifconfig tell you?
03:14|-|JoY changed nick to Guest51
03:14<burwaco>hold on, I need to get that from the other pc...
03:14<bcochofel>jm_: thx very mutch
03:14<bcochofel>*much
03:15<jm_>bcochofel: no worries
03:15<burwaco>kmap, where do I dump it ?
03:15<kmap>burwaco, Just tell me if wlan0/eth0 are found
03:15<Belisarivs>burwaco, I have some experience installing dlink.\
03:15<bcochofel>jm_: byt the way, what's does s.d.o. mean?
03:16<burwaco>kmap, wlan0 remaps to eth1...
03:16<jm_>bcochofel: security.debian.org or snapshot.debian.org or maybe something other too
03:16<burwaco>and eth1 gets a weirg hw address
03:16<jm_>ahh wrong, it's snapshot.debian.net
03:16<bcochofel>jm_: thx
03:16<Belisarivs>it is pretty crappy wifi which doesn't contain own firmware. You must use hostap driver, blacklist orinoco driver and download firmware
03:16<jm_>bcochofel: see above as well
03:16|-|libereco [~libereco@189.175.119.34] has joined #debian
03:17<burwaco>Belisarivs, did you have the same problem ?
03:17<Belisarivs>I got D-Link D-520 working on Ubuntu. Therefore it could be similar for you.
03:18|-|ukine-server [~ukine@67-70.200-68.tampabay.res.rr.com] has quit [Quit: Leaving]
03:18|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
03:18<burwaco>Belisarivs, yes, it works on ubuntu, but I'd like to get it to work on etch....
03:18<burwaco>I get errors like "eth1: unknown hardware address type 801"
03:19<Belisarivs>Then download hostap driver and rest is same.
03:19<Belisarivs>did you blacklist orinoco driver?
03:19<burwaco>Belisarivs, I think the hostap driver is on it right now...
03:20<burwaco>Socket 0 Bridge: [yenta_cardbus] (bus ID: 0000:00:08.0)
03:20<burwaco>Socket 0 Device 0: [hostap_cs] (bus ID: 0.0)
03:20|-|serge [~serge@87.252.251.31] has joined #debian
03:20|-|rpv [~rpv@212.57.191.72] has joined #debian
03:21<Belisarivs>And did you download and set firmware in /etc/networking/options?
03:21<burwaco>no
03:21|-|Melais [~Melais@intranet.zonepro-network.net] has quit [Quit: Melais]
03:21<burwaco>Belisarivs, how do I do that ?
03:21<Belisarivs>Also, some version of firmware is reported to be corrupt.
03:22<burwaco>Belisarivs, how commes everything worked fine during install, and not after?
03:22<Belisarivs>http://ubuntuforums.org/showthread.php?t=198568
03:22<alex__>anyone have any experience with vmware + smoothwall/ipcop/monowall?
03:23<Belisarivs>Aha, you installed whole system via netinstall and after rebooting it no longer works? Weird.
03:23<burwaco>Belisarivs, thx, I'll be reading that for a while...
03:24|-|smash [~smash@202.83.55.31] has joined #debian
03:24<serge>Hello! I'm trying to automate Deb Etch installation process. Now I'm creating preseed file. I've read decent piece of doc on debian.org about this subject, but there is only example of such file which mentions to install from the net. I need to install from DVD. Can anybody give me an example of the preseed directives to install from dvd?
03:25<Belisarivs>Btw, you didn't say what type do you have. It could ease search a lot.
03:25|-|ewanm89_laptop [~ewanm89@host81-159-254-36.range81-159.btcentralplus.com] has quit [Quit: Bye]
03:26<smash>hello everyone.
03:26<smash>I used ndiswrapper to install the driver for my wireless ethernet. Now how can i make the setup load automaticallly in the boot up.
03:26|-|juancgt [~juancgt@c-76-17-127-141.hsd1.ga.comcast.net] has quit [Quit: Leaving]
03:26<kmap>smash: IIRC adding ndiswrapper to /etc/modules loads the kernel module on bootup
03:27|-|ao2 [~u@2001:1418:117::1] has joined #debian
03:27<jm_>serge: it's in d-i Wiki
03:27<kmap>smash, Also, I don't recall, there's some command line option in ndiswrapper which does this for you (-m?)
03:27|-|Imposible_gUrL [~hudanetca@222.124.60.66] has quit [Quit: Leaving]
03:27<smash>kmap. i tried it but not working
03:28<smash>kmap i did ndiswrapper -m then i went for adding ndiswrapper in /etc/modules. but again not getting
03:29<jm_>serge: and in installation manual too
03:29<kmap>smash: Sorry, can't figure it out!
03:30|-|juancgt [~juancgt@c-76-17-127-141.hsd1.ga.comcast.net] has joined #debian
03:30|-|varka [~varkatope@p54A5EF44.dip.t-dialin.net] has joined #debian
03:31<smash>kmap: every thing i have done as you said but... even the ip is not setting. i can't ping
03:31<Belisarivs>So, ehm, could someone help me with usplash?
03:31<kmap>smash: Hey, have you set the needful in /etc/network/interfaces?
03:32<bcochofel>Where can I find the pkg_config ?
03:32|-|serge [~serge@87.252.251.31] has quit [Quit: õÈÏÖÕ Ñ ÏÔ ×ÁÓ]
03:33<smash>when i set the interfaces the ip set. but again i can't ping.
03:33|-|libereco [~libereco@189.175.119.34] has quit [Quit: Ex-Chat]
03:34|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
03:35<kmap>smash: Do you use DHCP?
03:36<smash>no. we set the ip static
03:36<kmap>smash: Oh, OK.
03:37|-|rpv [~rpv@212.57.191.72] has quit [Quit: Leaving]
03:38|-|benbss [~benbss@p549DF268.dip.t-dialin.net] has joined #debian
03:39|-|mode/#debian [+l 294] by debhelper
03:39|-|alex_ [~alexalex@62-249-237-101.no-dns-yet.enta.net] has joined #debian
03:39|-|mic [~mic@79-72-76-2.dynamic.dsl.as9105.com] has quit []
03:39|-|kmap [~kmap@barmen.interhost.no] has left #debian []
03:40|-|streuner [~streuner@p54A5E639.dip.t-dialin.net] has joined #debian
03:41|-|Glenn^BF [~fburlet@user-85-201-4-202.tvcablenet.be] has quit [Remote host closed the connection]
03:41|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has quit [Quit: leaving]
03:46|-|alex__ [~alexalex@62-249-237-101.no-dns-yet.enta.net] has quit [Ping timeout: 480 seconds]
03:46|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has quit [Read error: Connection reset by peer]
03:47|-|Melais [~Melais@intranet.zonepro-network.net] has joined #debian
03:47|-|benbss [~benbss@p549DF268.dip.t-dialin.net] has quit [Quit: Verlassend]
03:47|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has joined #debian
03:48<bcochofel>Hi, I need some help to config my sound. My lspci output is 04:01.0 Audio device: VIA Technologies, Inc. VIA High Definition Audio Controller (rev 10)
03:48|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
03:49<bcochofel>I don't know how to check if I have this installed or not but I don't have any mixer output on my gkrellm vol plugin
03:49<suiside>can you start alsamixer from a terminal?
03:50<jMCg>dpkg -l | grep
03:50<dpkg>No packages found matching | grep
03:51|-|debiantion [~user@IGLD-84-229-82-231.inter.net.il] has joined #debian
03:51<bcochofel>suiside: alsamixer: function snd_ctl_open failed for default: No such device
03:52<suiside>bcochofel: okay, you need to load the kernel module for your audio device
03:52|-|juancgt [~juancgt@c-76-17-127-141.hsd1.ga.comcast.net] has quit [Remote host closed the connection]
03:52<bcochofel>suiside: never done that under debian
03:53<jm_>bcochofel: run dpkg-reconfigure linux-sound-base
03:53<bcochofel>suiside: I come from suse where everything happens behind the scenes and one don't learn a thing about it
03:53<bcochofel>jm_: ALSA || OSS ?
03:54<jm_>ALSA
03:54<bcochofel>jm_: only that?!! Cool
03:54<bcochofel>thx
03:55<jm_>!alsa checklist
03:55<dpkg>alsa-checklist is probably 1) run alsaconf as root user 2) add your user to the 'audio' group (log out and log again in) 3) use alsamixer and make sure levels are up and it is unmuted 4) arts or esound stopped? 5) OSS modules unloaded? 6) speakers on? 7) modprobe snd-pcm-oss 8) does `cat /dev/urandom > /dev/dsp` work for root?
03:55|-|M_Durant [olli@KGM073.UNI-MUENSTER.DE] has quit [Read error: Connection reset by peer]
03:56|-|lesya [lesya@dialup-5400-1.86.57.187.4.telecom.mogilev.by] has joined #debian
03:58|-|Scurz [~sfantar@home.snurf.info] has joined #debian
03:58<bcochofel>jm_: your the best. one more thing, I always get confused adding a user to a group. can I use adduser --group audio ?
03:58<jm_>bcochofel: "/msg dpkg audio" tells you how to do that
03:58<suiside>bcochofel: 'gpasswd -a user group'
03:59<jm_>bcochofel: ohh it doesn't, use adduser the syntax is in the man page
04:00<niru>jm_, I have an iso image
04:00<niru>I want to do netinstall of that 6.1MB netboot image
04:00<niru>I have the codename as "pango" instead of etch or testing
04:01<niru>will my netinstall work
04:01<bcochofel>jm_, suiside : thx both for all your help
04:01<bcochofel>brb
04:01|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has quit [Quit: leaving]
04:02<lesya>can't connect nokia 3220 to PC through COM-cable. Tried to start MOBILedit! under Wine, but it doesn't see COM.
04:02|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has joined #debian
04:03|-|smash [~smash@202.83.55.31] has left #debian [Leaving]
04:03|-|Colin [~Colin@spc2-lanc4-0-0-cust430.asfd.broadband.ntl.com] has joined #debian
04:03|-|Colin [~Colin@spc2-lanc4-0-0-cust430.asfd.broadband.ntl.com] has left #debian []
04:03|-|burwaco [~burwaco@12.149-244-81.adsl-dyn.isp.belgacom.be] has quit [Quit: Leaving]
04:04|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
04:05|-|Melais [~Melais@intranet.zonepro-network.net] has quit [Quit: Melais]
04:07|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has joined #debian
04:07|-|schoinobates [~lmamane@2001:888:19f0:2:2e0:81ff:fe54:abf9] has joined #debian
04:09<bcochofel>jm_, suiside : my sound appears on my gkrellm plugin now
04:10|-|Melais [~Melais@intranet.zonepro-network.net] has joined #debian
04:11|-|Hessophanes [~jcn@dslb-088-073-051-180.pools.arcor-ip.net] has joined #debian
04:13|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has joined #debian
04:13|-|themill [~stuart@phoenix.chm.bris.ac.uk] has joined #debian
04:15|-|mrfan [~mrfan@87.19.63.185] has quit [Quit: Leaving]
04:19|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has quit [Remote host closed the connection]
04:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
04:20|-|Administrator [~Administr@60.218.58.70] has joined #debian
04:20|-|Administrator [~Administr@60.218.58.70] has quit []
04:22|-|H [~h@tor-irc.dnsbl.oftc.net] has joined #debian
04:23<kintaro0e>hi all, how can i make static ip on my wireless access, i use network manager applet?
04:25|-|bcochofe1 [~bcochofel@195-23-69-52.net.novis.pt] has joined #debian
04:25|-|k-man_ [~jason@ppp121-44-11-242.lns4.syd7.internode.on.net] has joined #debian
04:25|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has joined #debian
04:26|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has quit [Read error: Connection reset by peer]
04:27|-|lesya [lesya@dialup-5400-1.86.57.187.4.telecom.mogilev.by] has quit [Ping timeout: 480 seconds]
04:28|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has quit [Read error: Connection reset by peer]
04:29|-|mrfan [~mrfan@87.19.63.185] has joined #debian
04:29|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has joined #debian
04:30|-|oberon [~oberon@f048032052.adsl.alicedsl.de] has quit [Remote host closed the connection]
04:31|-|vnode [~oberon@f048032052.adsl.alicedsl.de] has joined #debian
04:31|-|cyfer [~cfr@h162n2fls304o885.telia.com] has joined #debian
04:31<schoappied>test123
04:32|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has quit [Remote host closed the connection]
04:32|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has joined #debian
04:32<k-man_>i have a usb dual dvb-t tuner, but only one of the tuners shows up in /dev/dvb
04:33<k-man_>any ideas how I might track down why?
04:33|-|xuwei [xuwei@222.85.68.98] has quit [Quit: Leaving]
04:34|-|bcochofe1 [~bcochofel@195-23-69-52.net.novis.pt] has quit [Ping timeout: 480 seconds]
04:34|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
04:37|-|derSmutje [~dersmutje@130.75.237.32] has joined #debian
04:37|-|e-t172 [e-t172@81.34.100-84.rev.gaoland.net] has joined #debian
04:37|-|myles [~myles@bas10-toronto12-1096759220.dsl.bell.ca] has quit [Ping timeout: 480 seconds]
04:38|-|Belisarivs [~Belisariv@5.56.rychly-net.cz] has quit [Quit: Leaving]
04:39|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has quit [Remote host closed the connection]
04:39|-|H [~h@tor-irc.dnsbl.oftc.net] has quit [Quit: Konversation terminated!]
04:39|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has joined #debian
04:39|-|Deane [~chatzilla@eduss.dsl.onthenet.net] has joined #debian
04:39<Deane>Hey all. Wonder if I could get a hand from someone. Got a new DELL SC440 with a broadcomm NIC.
04:40<Deane>I've updated my kernel, and it's just not liking this NIC. The old DELL SC430 is fine.
04:41<petemc>i use bnx2 for the broadcom nics in my dells
04:41<jMCg>Deane: define 'not liking', in the context of software, please.
04:41<twb>I want to automate or partially automate installation and configuration of a "base" Debian deployment for hosts which will then be deployed at customer sites. Is FAI useful in this case, or do I simply want preseeding?
04:41<Deane>pcimodules says I need to use TG3, modprobed that and still can't get eth0 up. Says it's an unknown device. but dmesg | grep eth0 gives me the impression that it's there
04:41<Deane>jMCg: sorry :P Basically ifup says eth0 is an unknown device.
04:42<petemc>Deane: what does lspci say about your nic?
04:42<Deane>It finds ti
04:42<petemc>oh, thats useful
04:42<Deane>Broadcomm 95754 I think. Checking exact now
04:42<Deane>(gotta run to server room)
04:43<twb>Boo broadcom. Boo, hiss.
04:43<Deane>Broadcom NetXtreme BCM9754
04:44<Deane>It does say it's a PCI Express NIC. So not sure if that affects anything
04:46<Deane>Tried to modprobe bnx2, but that doesn't help.
04:46|-|d0rt [~ni@69.177.45.213] has quit [Quit: Konversation terminated!]
04:47|-|berto [~berto@fanzine.igalia.com] has joined #debian
04:48|-|schoinobates [~lmamane@2001:888:19f0:2:2e0:81ff:fe54:abf9] has quit [Remote host closed the connection]
04:48|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
04:48|-|TeLLuS [~johan@itpat.cygatemaldata.se] has joined #debian
04:49<petemc>Deane: google knows nothing of a broadcom nic by that name
04:49<petemc>unless my google is teh b0rken
04:49<twb>Deane: what is the exact output of lspci | grep Ethernet
04:49<twb>petemc: it is, but that's an unrelated issue
04:50<Deane>Argh.. 5754
04:50|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has joined #debian
04:50<Deane>Not 9754
04:50<Deane>I'm going to try recompile the TG3 driver from broadcom's site.
04:50<twb>Yecch
04:51<twb>No way would I trust vendor drivers
04:51|-|FaUsT [~faust@213-156-52-100.fastres.net] has joined #debian
04:51|-|noname001 [~pawel@82-32-102-47.cable.ubr01.hawk.blueyonder.co.uk] has quit [Ping timeout: 480 seconds]
04:51<Deane>Googling around someone suggests you should alias eth0 to tg3...
04:51<Deane>8. Do this :
04:51<Deane>Code:
04:51<Deane>make
04:51<Deane>insmod tg3.ko
04:51<Deane>vim /etc/modprobe.d/aliases
04:51<Deane>Add a line : alias eth0 tg3
04:51|-|FaUsT [~faust@213-156-52-100.fastres.net] has quit [Remote host closed the connection]
04:51<Deane>Does that sound right?
04:52|-|Optical [~dlz@248.35.188.60.broad.tz.zj.dynamic.163data.com.cn] has quit [Ping timeout: 480 seconds]
04:52|-|paw [meow@100-12.dsl.otton1.isp.cyberus.ca] has quit [Ping timeout: 480 seconds]
04:52<Deane>What I don't get is that dmesg clearly shows eth0 as a device. I get eth0: Tigon3....
04:52|-|paw [meow@100-12.dsl.otton1.isp.cyberus.ca] has joined #debian
04:53<Deane>Lemme dump the lspci stuff to my USB key. Then I can paste it exactly
04:56<Deane>eth0: Tigon3 [partno(BCM95754) rev b002 PHY(5787)] (PCI Express) 10/100/1000Base-T Ethernet 00:1a:a0:20:46:f5
04:56<Deane>eth0: RXcsums[1] LinkChgREG[0] MIirq[0] ASF[0] WireSpeed[1] TSOcap[1]
04:56<Deane>eth0: dma_rwctrl[76180000] dma_mask[64-bit]
04:56<Deane>That was dmesg... this is lspci...
04:56<Deane>04:00.0 Ethernet controller: Broadcom Corporation NetXtreme BCM5754 Gigabit Ethernet PCI Express (rev 02)
05:00|-|pasquik [~pasquik@81-174-58-114.staticnet.ngi.it] has joined #debian
05:02<dli>Deane, what kernel version?
05:04|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
05:05<Deane>2.16.21
05:05|-|vnode [~oberon@f048032052.adsl.alicedsl.de] has quit [Remote host closed the connection]
05:05|-|mrfan [~mrfan@87.19.63.185] has quit [Quit: Leaving]
05:06|-|leo [~leo@122.161.15.51] has joined #debian
05:06|-|mrfan [~mrfan@87.19.63.185] has joined #debian
05:06<leo>hi anybody with newt programming skills?
05:07|-|rzawutang44 [~guile@88.140.89.219] has joined #debian
05:09<alex_>anyone have any experience with vmware + smoothwall/ipcop/monowall?
05:10|-|Le_Vert [~gandalf@81.56.128.63] has quit [Remote host closed the connection]
05:11|-|pasquik [~pasquik@81-174-58-114.staticnet.ngi.it] has quit [Quit: Sto andando via]
05:11<Deane>dli: To be exact : Linux edussserver 2.6.21-2-486 #1 Wed Jul 11 03:17:09 UTC 2007 i686 GNU/Linux
05:11|-|vnode [~oberon@f048032052.adsl.alicedsl.de] has joined #debian
05:11|-|pasquik [~pasquik@81-174-58-114.staticnet.ngi.it] has joined #debian
05:11|-|leo [~leo@122.161.15.51] has quit [Remote host closed the connection]
05:14|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has joined #debian
05:15|-|rubia [~usuario@200.Red-80-32-192.staticIP.rima-tde.net] has joined #debian
05:15<rubia>ola
05:15<rubia>ola
05:16<rubia>ahi algien
05:16|-|FaUsT [~faust@213-156-52-100.fastres.net] has joined #debian
05:16<rubia>ola
05:16<rubia>contesta
05:16|-|FaUsT [~faust@213-156-52-100.fastres.net] has quit [Read error: Connection reset by peer]
05:16<rubia>ol
05:16<rubia>a
05:16|-|rubia [~usuario@200.Red-80-32-192.staticIP.rima-tde.net] has quit []
05:17<dli>Deane, try the newest stable kernel from kernel.org
05:17|-|njende [~njende@p5B0FE6E6.dip.t-dialin.net] has joined #debian
05:19<Deane>kk
05:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
05:19<Deane>Sorry to be so... amature, but how do I change my kernel/
05:19<Deane>?
05:19<Deane>Gotta recompile it from scratch right?
05:20<dli>Deane, yes
05:20<Deane>kk
05:20<Deane>Thanks
05:20<Deane>Gonna do it at home though
05:20<dli>Deane, read this: http://ubuntuforums.org/showthread.php?t=251175
05:21<kexbar>whois
05:22<Deane>*nod* I found that earlier. Tried to compile the src myself. I guess I should try convert the RPM to a deb?
05:22<kexbar>你们好阿!
05:23<dli>Deane, what?
05:23<dli>kexbar, this is an English-only channel
05:23<dli>!tell kexbar about cn
05:23<kexbar>:-( ok, sorry!
05:23<Deane>Ah. Ok so looks like the new kernel should fix it.
05:24<Deane>Weird that 2.6.21 didn't
05:24<Deane>The most bizarre thing is it does get modprobed
05:24<Deane>It comes up saying eth0 : Tigon3
05:24|-|Ten [~ten@88-96-94-193.dsl.zen.co.uk] has joined #debian
05:24<dli>Deane, yes, try 2.6.22 kernel first, if doesn't solve the problem, you may have to build ubuntu kernel
05:25<Deane>*cry* kk :P
05:25<Deane>thx guys
05:25<Deane>*waves*
05:25|-|Deane [~chatzilla@eduss.dsl.onthenet.net] has quit [Quit: ChatZilla 0.9.78.1 [Firefox 2.0.0.5/2007071317]]
05:27|-|linux-fox [~linux-fox@60.218.58.70] has joined #debian
05:28<linux-fox>hello , everyone
05:28|-|piju [~piju@magnifix.com.my] has joined #debian
05:30|-|panic0001 [~nico@213.200.99.158] has joined #debian
05:30|-|panic0001 [~nico@213.200.99.158] has left #debian []
05:30|-|talyz [~talyz@h-82-96-59-131.auto.rp80.se] has joined #debian
05:33<linux-fox>who use shoerwall as the firewall
05:34<JasonS>linux-fox: best just ask your real question and be patient
05:34|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
05:34|-|free-zombie [someone@pD9E32054.dip.t-dialin.net] has joined #debian
05:36|-|kop [~kop@meme-net.meme.com] has joined #debian
05:36<linux-fox>JasonS: please , i only study shorewall for a moment
05:36<linux-fox>i use it as my router
05:38|-|bzed [~bzed@dslb-084-059-110-198.pools.arcor-ip.net] has joined #debian
05:39|-|mode/#debian [+l 303] by debhelper
05:39|-|sep [~sep@40.211.jostedal.no] has quit [Quit: Leaving]
05:39|-|pharm [phil@mail.kantaka.co.uk] has joined #debian
05:39<pharm>Is epiphany borked in etch?
05:41<dli>!tell pharm about ask
05:41<pharm>?
05:42<pharm>OK. After updating my etch install this morning, epiphany dies with: ** (epiphany-browser:22950): WARNING **: An error occured while calling remote method: Did not receive a reply. ...
05:42<linux-fox>i only install the dhcp and shorewall in my router with pc , otherwise , i donot understand
05:43<pharm>Any suggestions appreciated.
05:43<pharm>(epiphany never gets to even put up a window btw.)
05:44<dli>pharm, what's your epiphany version? " dpkg -s epiphany "
05:44<pharm>dpkg -s epiphany-browser ... Version: 2.14.3-6
05:44<dpkg>You Fool! epiphany-browser ... Version: 2.14.3-6 is installed!
05:45<pharm>oops
05:45[~]pharm waves to dpkg
05:45<pharm>Version: 2.14.3-6
05:45|-|pasquik [~pasquik@81-174-58-114.staticnet.ngi.it] has quit [Quit: Sto andando via]
05:46<pharm>maybe I need to log out & in again?
05:46<dli>pharm, if you are running gnome, try that
05:46<pharm>worth a go. back in bit...
05:46|-|pharm [phil@mail.kantaka.co.uk] has left #debian []
05:49|-|pharm [phil@mail.kantaka.co.uk] has joined #debian
05:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
05:49<pharm>OK. That seems to have fixed it.
05:51|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has quit [Quit: Leaving]
05:52|-|monra [~monra@147.52.193.38] has joined #debian
05:52<monra>hello
05:52<monra>i want to copy an iso file to a Cd
05:52|-|si0ux [~si0ux@201-048-208-161.static.ctbctelecom.com.br] has joined #debian
05:53|-|si0ux [~si0ux@201-048-208-161.static.ctbctelecom.com.br] has quit [Read error: Connection reset by peer]
05:53<djuLoq>Pharm, would you say that you rebooted and experienced an instance of epiphany?
05:53<monra>but k3b doesn't find my cdrw device
05:53<djuLoq>monra; many tools, including k3b burning utility can do....oooo yeah
05:53|-|filippo [~filippo@85-18-136-73.fastres.net] has joined #debian
05:54<monra>djuLoq, what devices should I add from /dev/
05:54<dli>monra, just in case, do: modprobe ide-cd
05:54<monra>i tried /dev/cdrom and some similars but no sucess
05:54<monra>dli, where should i do this?
05:55|-|si0ux [~si0ux@201-048-208-161.static.ctbctelecom.com.br] has joined #debian
05:55<djuLoq>/dev/cdrw?
05:55|-|filippo changed nick to pippo
05:55<dli>monra, as root, run " modprobe ide-cd " , restart k3b
05:56|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has joined #debian
05:56|-|pippo [~filippo@85-18-136-73.fastres.net] has quit []
05:58<monra>thanks worked
05:58|-|si0ux [~si0ux@201-048-208-161.static.ctbctelecom.com.br] has quit []
06:00<dli>monra, one tip, always choose "verify data" in k3b. so you won't be asking how to write it correctly, later
06:00<monra>oh, ok
06:01|-|Fjordside changed nick to Guest56
06:01|-|Fjordside [~JMF@90.185.54.203] has joined #debian
06:03|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has quit [Quit: smeding go bye bye.]
06:04|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
06:05|-|dpkg [~dpkg@rzlab.ucr.edu] has quit [Quit: buh bye!]
06:05|-|dpkg [~dpkg@rzlab.ucr.edu] has joined #debian
06:05|-|Skyrail [~Skyrail@212.32.96.173] has joined #debian
06:07|-|Guest56 [~JMF@90.185.54.203] has quit [Ping timeout: 480 seconds]
06:08|-|kexbar [~kexbar@mail.nj.cpsecure.com] has quit [Quit: Leaving]
06:08<blaheva>whats an easy way to run the xorg configuration in debian?
06:08<pharm>djuLoq: That's terrible. (Although I didn't reboot: just logged out and in again...)
06:09<gsimmons>!tell blaheva -about drxx
06:09|-|wangjing [~wangjing@124.200.131.159] has joined #debian
06:09|-|linux-fox [~linux-fox@60.218.58.70] has quit [Ping timeout: 480 seconds]
06:10|-|linux-fox [~linux-fox@60.218.58.70] has joined #debian
06:10|-|piju [~piju@magnifix.com.my] has quit [Remote host closed the connection]
06:10|-|monra [~monra@147.52.193.38] has quit [Ping timeout: 480 seconds]
06:10|-|wangjing [~wangjing@124.200.131.159] has quit []
06:13|-|TeLLuS [~johan@itpat.cygatemaldata.se] has left #debian [hmm]
06:14|-|d0rt [~ni@d210h212.public.simons-rock.edu] has joined #debian
06:17<Rajohan`Linux>how can i chmode a folder to 701?
06:17<Rajohan`Linux>chmod*
06:17|-|monra [~monra@147.52.193.38] has joined #debian
06:17<monra>hello again
06:17|-|wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
06:18<wei>hi
06:18<monra>guys, I ruined my GCC and now i cannot do much. when i try compiling a program i see stdio.h not found
06:18<monra>any ideas how to reinstall GCC
06:18<monra>?
06:18<manphiz>monra, apt-get install build-essential
06:18|-|njende [~njende@p5B0FE6E6.dip.t-dialin.net] has quit [Remote host closed the connection]
06:19<gsimmons>Rajohan`Linux: 'chmod 701 folder'
06:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
06:19<monra>W: You may want to run apt-get update to correct these problems
06:19<monra>E: Couldn't find package build-essential
06:19<Rajohan`Linux>ok
06:19|-|chealer [~chealer@205.205.247.56] has quit [Ping timeout: 480 seconds]
06:19<dli>monra, try: apt-get install kernel-package
06:20<monra>i fixed the sources.list and now the first command works.. i think.. installing right now
06:22|-|E0x [~moya@133.87.3.196.l.sta.codetel.net.do] has joined #debian
06:22|-|Althaser [~GNU@bl8-61-37.dsl.telepac.pt] has quit [Ping timeout: 480 seconds]
06:22|-|piju [~piju@magnifix.com.my] has joined #debian
06:23|-|zumbi [~zumbi@87.219.132.157] has quit [Ping timeout: 480 seconds]
06:24|-|kpan1c [~kpan1c@tor-irc.dnsbl.oftc.net] has quit [Remote host closed the connection]
06:24|-|ilia [~ilia@ilia.sharcom.org] has joined #debian
06:24|-|kpan1c [~kpan1c@anonymisierungsdienst2.foebud.org] has joined #debian
06:25|-|manphiz [dxy@218.244.247.198] has quit [Remote host closed the connection]
06:25|-|manphiz [dxy@218.244.247.198] has joined #debian
06:26|-|vnode [~oberon@f048032052.adsl.alicedsl.de] has quit [Quit: Leaving]
06:27|-|ilia [~ilia@ilia.sharcom.org] has quit []
06:27<monra>fixed!
06:27<monra>thanks guys
06:27|-|wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has quit [Quit: Leaving]
06:29|-|d0rt [~ni@d210h212.public.simons-rock.edu] has quit [Ping timeout: 480 seconds]
06:29|-|mode/#debian [+l 296] by debhelper
06:29|-|mjk [~mjk@p54AC68E9.dip.t-dialin.net] has joined #debian
06:29|-|theo_ [~Kasko@LPuteaux-151-43-27-85.w193-252.abo.wanadoo.fr] has joined #debian
06:29|-|theo_ [~Kasko@LPuteaux-151-43-27-85.w193-252.abo.wanadoo.fr] has quit []
06:30|-|wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
06:30|-|hazard2 [~hazard@71.174.54.250] has joined #debian
06:30<wei>
06:30|-|wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has quit []
06:32|-|Nephelauxetic [~nschmid@froggy.ethz.ch] has joined #debian
06:33|-|Holborn [~holborn@237.Red-217-125-137.staticIP.rima-tde.net] has joined #debian
06:35|-|blaheva [~blaheva@tor-irc.dnsbl.oftc.net] has quit [Remote host closed the connection]
06:35|-|Nephelauxetic [~nschmid@froggy.ethz.ch] has quit []
06:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
06:37|-|sow [~sow@sk1-131.szpital.zabrze.pl] has joined #debian
06:39|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has joined #debian
06:40|-|slaxz [~slaxz@p54B47957.dip.t-dialin.net] has joined #debian
06:40|-|sow [~sow@sk1-131.szpital.zabrze.pl] has quit []
06:42|-|mrfan_ [~mrfan@host152-102.pool80181.interbusiness.it] has joined #debian
06:43|-|kamila [~kamila@gvb178.internetdsl.tpnet.pl] has joined #debian
06:43|-|pharm [phil@mail.kantaka.co.uk] has quit [Quit: ircII EPIC4-2.6 -- Are we there yet?]
06:44|-|frank [~frank@remetter.de] has joined #debian
06:44|-|kamila [~kamila@gvb178.internetdsl.tpnet.pl] has quit []
06:44|-|ROOTweiller [~deblfpser@200.109.134.245] has joined #debian
06:45|-|torti- [~torti@c212228.adsl.hansenet.de] has joined #debian
06:46|-|chealer [~chealer@205.205.252.26] has joined #debian
06:48|-|db [~db@e180255067.adsl.alicedsl.de] has joined #debian
06:48|-|mrfan [~mrfan@87.19.63.185] has quit [Ping timeout: 480 seconds]
06:48<torti->hi after 'apt-get update && apt-get dist-upgrade" i get "The following packages have been kept back: file libfreetype6 libkrb53 libmagic1" how do i fix this?
06:49|-|mode/#debian [+l 305] by debhelper
06:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
06:50<Cave`>maybe apt-get autoremove
06:53<jm_>!kept back
06:53|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has quit [Read error: Connection reset by peer]
06:53<dpkg>kept back is probably when packages have not been upgraded, even though newer versions are available, because it cannot resolve dependencies for the newer version, or when you told it to hold packages, or when you used "upgrade" instead of "dist-upgrade". The safest way to resolve this is perhaps to 'apt-get -s install <kept-package>' and see why it wasn't automatically upgrading the package
06:53|-|tycale [~tycale@55.79-244-81.adsl-dyn.isp.belgacom.be] has joined #debian
06:53<tycale>Hi
06:54|-|knoppix_ [~knoppix@241.pool85-50-33.dynamic.orange.es] has joined #debian
06:54|-|knoppix_ [~knoppix@241.pool85-50-33.dynamic.orange.es] has quit []
06:55|-|kmap [~kmap@barmen.interhost.no] has joined #debian
06:55|-|kmap [~kmap@barmen.interhost.no] has left #debian []
06:55|-|kmap [~kmap@barmen.interhost.no] has joined #debian
06:55|-|dracozna [~dracozna@cc408686-b.leek1.gr.home.nl] has quit [Remote host closed the connection]
06:55|-|kmap [~kmap@barmen.interhost.no] has left #debian []
06:55|-|kmap [~kmap@barmen.interhost.no] has joined #debian
06:56|-|kmap [~kmap@barmen.interhost.no] has left #debian []
06:56|-|kmap [~kmap@barmen.interhost.no] has joined #debian
06:56|-|kmap [~kmap@barmen.interhost.no] has left #debian []
06:56|-|kmap [~kmap@barmen.interhost.no] has joined #debian
06:57|-|lambda [~lambda@84.7.112.88] has joined #debian
06:58<monra>hey guys. I'm interested in installing the apropriate librarires in g++ to have vectors, lists and so in, I mean the STL library
06:58<monra>any ideas what should i do?
06:59|-|kmap [~kmap@barmen.interhost.no] has left #debian []
06:59<manphiz>monra, after 'apt-get install build-essential' you've already got all of them.
06:59|-|kmap_ [~kmap@barmen.interhost.no] has joined #debian
06:59|-|kmap_ [~kmap@barmen.interhost.no] has left #debian []
06:59<monra>really? thanks
06:59<monra>let me try ! :)
07:00|-|lupine_ [lupine@nick.lupine.me.uk] has joined #debian
07:01|-|kmap [~kmap@barmen.interhost.no] has joined #debian
07:01|-|lupine [lupine@nick.lupine.me.uk] has quit [Read error: Network is unreachable]
07:02|-|_spOOn_ [~adam@219-90-201-165.static.adam.com.au] has quit [Quit: Leaving]
07:03|-|kmap [~kmap@barmen.interhost.no] has left #debian []
07:04|-|kmap [~kmap@barmen.interhost.no] has joined #debian
07:05|-|Frolic [~ederm@frolic.user.oftc.net] has joined #debian
07:05|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
07:06|-|rill [~Miranda@221.1.223.3] has joined #debian
07:06<frank>monra: in etch it's libstdc++6-4.1-dev
07:06<monra>i got sarge
07:06<frank>which is a dependency of g++-4.1
07:07|-|si0ux [~si0ux@201-048-208-161.static.ctbctelecom.com.br] has joined #debian
07:07|-|si0ux [~si0ux@201-048-208-161.static.ctbctelecom.com.br] has quit []
07:07<frank>so i guess installing g++ gives you what you need
07:07|-|Le_Vert [~gandalf@81.56.128.63] has joined #debian
07:08|-|talyz [~talyz@h-82-96-59-131.auto.rp80.se] has quit [Remote host closed the connection]
07:08|-|piju [~piju@magnifix.com.my] has quit [Quit: Leaving]
07:09<frank>sarge is libstdc++5-3.3-dev
07:11|-|slaxz [~slaxz@p54B47957.dip.t-dialin.net] has quit [Remote host closed the connection]
07:13|-|rill [~Miranda@221.1.223.3] has quit [Quit: Miranda IM! Smaller, Faster, Easier. http://miranda-im.org]
07:14|-|Piet [~piet@tor.noreply.org] has joined #debian
07:14|-|d0rt [~ni@d210h5.public.simons-rock.edu] has joined #debian
07:18|-|H [~h@tor-irc.dnsbl.oftc.net] has joined #debian
07:18|-|hazard2 [~hazard@71.174.54.250] has quit [Quit: This computer has gone to sleep]
07:20|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has joined #debian
07:20|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
07:21|-|Optical [~dlz@248.35.188.60.broad.tz.zj.dynamic.163data.com.cn] has joined #debian
07:22|-|mike [~mike@ip-58-28-157-222.ubs-dsl.xnet.co.nz] has joined #debian
07:22|-|paistis [paistis@a88-113-123-222.elisa-laajakaista.fi] has joined #debian
07:23|-|ROOTweiller [~deblfpser@200.109.134.245] has quit [Quit: Saliendo]
07:23|-|ranix [~ranix@wsip-70-167-22-214.ri.ri.cox.net] has joined #debian
07:23|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has quit [Read error: Connection reset by peer]
07:24|-|Cave` changed nick to Cave`afk
07:25|-|rhoruns [~rhoruns@ip68-230-90-30.ph.ph.cox.net] has joined #debian
07:25<ranix>hey all, I'm having trouble with XFCE4. I'm trying to run a script at login, but it looks like my saved session is overriding like everything (it sucks). How do I make XFCE4 run a script at login even when starting a saved session?
07:26|-|Eulex [~alex@85.235.5.10] has quit [Ping timeout: 480 seconds]
07:27|-|Le_Vert [~gandalf@81.56.128.63] has quit [Remote host closed the connection]
07:27<monra>anyway. does anybody have an idea how to make my speakers make sounf?
07:27<monra>sound?
07:27<ranix>apt-get install alsa alsatools alsa-utils
07:27<ranix>then, run alsaconf
07:28<ranix>then reboot
07:28<petemc>alsaconf shouldnt need a reboot
07:28|-|kintaro0e [~kintaro0e@cebu.exist.com] has quit [Quit: Leaving]
07:28|-|Hotaru [massar@bratwurst.unix-ag.uni-kl.de] has joined #debian
07:28<ranix>it does need users to log back in, however
07:29<ranix>as it adds the audio group if it doesn't already exist (which chances are it doesn't)
07:29<petemc>that should be done automagically, but ok..
07:29<petemc>at install time
07:29|-|albert [~albert@e176005218.adsl.alicedsl.de] has joined #debian
07:30<ranix>users won't have access to new group ownership until the next login
07:30<ranix>at least, this is how I understand it
07:30<jm_>wrong, they can easily use newgrp/sg
07:31<ranix>ah, I didn't know about newgrp
07:31<ranix>nifty
07:32<twb>Yes, changes to secondary groups do no take effect until the next login
07:32|-|Drago84 [~Drago84@host222-16-dynamic.17-87-r.retail.telecomitalia.it] has joined #debian
07:32<torti->solved it ([13:48:51] <torti-> hi after 'apt-get update && apt-get dist-upgrade" i get "The following packages have been kept back: file libfreetype6 libkrb53 libmagic1" how do i fix this?) - it was an old sarge system, after upgrade to etch all was fine - thx anyway for the help
07:32<twb>That is, changes do not affect existing logins
07:32|-|Drago84 [~Drago84@host222-16-dynamic.17-87-r.retail.telecomitalia.it] has quit []
07:33|-|Althaser [~GNU@bl9-252-231.dsl.telepac.pt] has joined #debian
07:33<twb>ranix: re xfce4, I just use an .Xclients script to start stuff
07:34<twb>ftp://twb.ath.cx/Preferences/.xsession
07:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
07:35|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has joined #debian
07:36|-|Eulex [~alex@85.235.5.1] has joined #debian
07:37|-|ROOTweiller [~deblfpser@200.109.134.245] has joined #debian
07:39|-|mode/#debian [+l 313] by debhelper
07:39|-|peter__ [peter@host-n1-118-194.telpol.net.pl] has joined #debian
07:41|-|ranix [~ranix@wsip-70-167-22-214.ri.ri.cox.net] has quit [Quit: BitchX-1.1-final -- just do it.]
07:41|-|debUsr42 [~sanctus@p54BA61AE.dip.t-dialin.net] has quit [Quit: Verlassend]
07:41|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has quit [Quit: Lämnar]
07:41|-|db [~db@e180255067.adsl.alicedsl.de] has quit [Quit: Verlassend]
07:42|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has joined #debian
07:42|-|meandtheshell [~markus@85.127.102.246] has quit [Quit: Leaving.]
07:43|-|torti- [~torti@c212228.adsl.hansenet.de] has quit []
07:43|-|rhoruns [~rhoruns@ip68-230-90-30.ph.ph.cox.net] has quit [Quit: Leaving]
07:44|-|dutche [~dutche@200.169.133.98] has joined #debian
07:44|-|Melais [~Melais@intranet.zonepro-network.net] has quit [Quit: Melais]
07:45|-|wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
07:45|-|gabrix [~gabrix@host144-83-dynamic.49-82-r.retail.telecomitalia.it] has joined #debian
07:46|-|mIRCTRUser-889 [mIRCTR@85.104.62.155] has joined #debian
07:46|-|gabrix [~gabrix@host144-83-dynamic.49-82-r.retail.telecomitalia.it] has quit []
07:46|-|mIRCTRUser-889 [mIRCTR@85.104.62.155] has quit []
07:48|-|meandtheshell [~markus@85.127.104.34] has joined #debian
07:49<monra>ranix.. i got these: apt-get install alsa alsatools alsa-utils
07:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
07:49<monra>Package alsa is a virtual package provided by:
07:49<monra> alsa-base 1.0.14-1
07:49<monra>You should explicitly select one to install.
07:49<monra>E: Package alsa has no installation candidate
07:49|-|monra kicked [#debian] debhelper [use the paster bot or #flood]
07:49|-|monra [~monra@147.52.193.38] has joined #debian
07:49<kmap>monra: Get alsa-base and alsa-utils
07:49<monra>how?
07:49<kmap>monra: sudo apt-get install alsa-base alsa-utils
07:50|-|m`m`w [~Simba@mm-119-244-209-82.adsl.mgts.by] has joined #debian
07:54|-|derSmutje [~dersmutje@130.75.237.32] has quit [Remote host closed the connection]
07:54|-|Sub-Zero [~desk@190.72.134.100] has joined #debian
07:55<alex_>does debian etch or sarge have good wireless support?
07:55<alex_>havent touched it yet, but im thinking about it
07:57<monra>kmap, i got the same error
07:58<kmap>monra: Strange... that shouldn't happen
07:58<monra>it did ;)
07:58<kmap>monra: What happens if you just do apt-get install alsa-base?
07:59<monra>0 upgraded, 0 newly installed, 0 to remove and 888 not upgraded.
07:59<kmap>monra: Now, did you try apt-get install alsa-utils?
07:59<kmap>monra: Rather, now try apt-get install alsa-utils
08:00<monra>the same
08:00<monra>!
08:01|-|SixF9 [africa@sixnine.us] has joined #debian
08:01<SixF9>hi
08:01<kmap>monra: See if alsaconf is already there
08:01<monra>how?
08:01<SixF9>is there a way to tell "apt-file update" to display a status?
08:02<kmap>monra: Just type alsaconf, or whereis alsaconf
08:02<SixF9>monra: or type "alsa" and TAB
08:02<SixF9>(but as root)
08:02<kmap>SixF9: No, alsaconf is not to be run as root if the user is in the audio group
08:02<monra>yes it is there
08:03<kmap>monra: Great!
08:03<kmap>monra: Now, log out and log back in
08:03<monra>and then will my speakers work?
08:03<kmap>monra: and run alsaconf to set your volumes
08:03<kmap>monra: Can't promise that! :-)
08:03<SixF9>kmap: its loads the kernel modules magically then?
08:03|-|southernc [~southernc@c-71-235-120-220.hsd1.ma.comcast.net] has joined #debian
08:03<monra>ok
08:03<kmap>SixF9: Oh, no!
08:03<kmap>monra: Wait
08:04<southernc>anyone know how to configure postfix to send mail through a different port and to authenticate >?
08:04<kmap>SixF9: Recommend a reboot?
08:04<SixF9>oh dear
08:04<kmap>SixF9: I don't know what to modprobe
08:05<SixF9>alsaconf loads the kernel modules. and i asked how it loads them if you dont run it as root
08:05<kmap>SixF9: Oh, I guess you are right
08:05|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
08:05<kmap>SixF9: Sorry for the goofup
08:05<SixF9>no harm done :)
08:05<kmap>monra: sudo alsaconf it is! :-)
08:08|-|mrfan_ [~mrfan@host152-102.pool80181.interbusiness.it] has quit [Read error: Connection reset by peer]
08:08|-|sangamon [~Dave@h58173.serverkompetenz.net] has joined #debian
08:08|-|piju [~piju@magnifix.com.my] has joined #debian
08:09|-|sangamon [~Dave@h58173.serverkompetenz.net] has quit []
08:11|-|Tontsa [~tony@dsl-hkigw8-fe1ef800-141.dhcp.inet.fi] has joined #debian
08:11|-|Tontsa [~tony@dsl-hkigw8-fe1ef800-141.dhcp.inet.fi] has quit []
08:11|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has quit [Remote host closed the connection]
08:11|-|mike [~mike@ip-58-28-157-222.ubs-dsl.xnet.co.nz] has quit [Quit: Leaving]
08:12|-|southernc [~southernc@c-71-235-120-220.hsd1.ma.comcast.net] has quit [Quit: [BX] We are BitchX of Borg. You will be assimilated. Using ircII is futile.]
08:12|-|mrfan [~mrfan@host152-102.pool80181.interbusiness.it] has joined #debian
08:13|-|hatoon [~musis@189.12.159.199] has joined #debian
08:14|-|antgel [~antony@192.117.42.252.static.012.net.il] has joined #debian
08:15|-|monra [~monra@147.52.193.38] has quit [Quit: Leaving]
08:15<hatoon>ola
08:15|-|Tontsa [~tony@dsl-hkigw8-fe1ef800-141.dhcp.inet.fi] has joined #debian
08:15|-|antgel [~antony@192.117.42.252.static.012.net.il] has quit []
08:15|-|Tontsa [~tony@dsl-hkigw8-fe1ef800-141.dhcp.inet.fi] has left #debian []
08:16<hatoon>alguem aqui fala portugues
08:16<stew>!br
08:16<dpkg>Este canal é apenas em inglês. Por favor, use #debian-br (/j #debian-br) para ajuda em portugues.
08:16|-|tycale [~tycale@55.79-244-81.adsl-dyn.isp.belgacom.be] has quit [Read error: Connection reset by peer]
08:16|-|fixxxer [~aavelar@189.135.136.77] has joined #debian
08:16|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has joined #debian
08:16|-|sangamon [~Dave@h58173.serverkompetenz.net] has joined #debian
08:16|-|SamuraiDio [~diovani@201-89-139-94.paebv701.dsl.brasiltelecom.net.br] has joined #debian
08:17|-|tycale [~tycale@55.79-244-81.adsl-dyn.isp.belgacom.be] has joined #debian
08:17<hatoon>stew, tu saca portugues
08:17<SamuraiDio>hatoon, debian-br, lingua oficial aqui é inglês
08:17<stew>hatoon: english only in here please, if you want to speak portuguese: /j #debian-br
08:18<hatoon>ok
08:18|-|hatoon [~musis@189.12.159.199] has left #debian [Saindo]
08:18<SamuraiDio>hi, recently, most of my cd records are being wrong and the disc become unusable... i use k3b with wodim 1.1.2-1
08:18<SamuraiDio>some clues?
08:20<SamuraiDio>i just updated wodim to testing (1.1.6-1) to try if it resolves...
08:20|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
08:21<SixF9>SamuraiDio: how old is the drive that you use to burn?
08:21|-|nomadium [~miguel@190.72.184.29] has quit [Ping timeout: 480 seconds]
08:22<SamuraiDio>it has one year, so so
08:22|-|marrup [~marrup@cable-dynamic-87-245-87-121.shinternet.ch] has joined #debian
08:23<SixF9>SamuraiDio: since i cant see a related bug to that problem i would investigate if a hardware problem causes this
08:25|-|marrup [~marrup@cable-dynamic-87-245-87-121.shinternet.ch] has quit []
08:26<SamuraiDio>yeah, maybe...
08:27<SamuraiDio>it there some other recording tool to gnu? it would be the only way i can test my hardware...
08:28|-|ruslan [~ruslan@194.44.127.82] has joined #debian
08:28|-|Melais [~Melais@intranet.zonepro-network.net] has joined #debian
08:28<SixF9>SamuraiDio: there is graveman e.g.
08:28|-|ruslan [~ruslan@194.44.127.82] has quit [Remote host closed the connection]
08:28<SamuraiDio>tnx
08:28|-|Cave`afk changed nick to Cave`
08:29|-|Metalqga [~metalqga@cable-84-43-141-59.mnet.bg] has joined #debian
08:29<twb>I blame daihatsu
08:29|-|Melais [~Melais@intranet.zonepro-network.net] has quit []
08:29|-|kart_ [~kart_@59.182.26.18] has quit [Quit: \|--|/]
08:29|-|Melais [~Melais@intranet.zonepro-network.net] has joined #debian
08:30|-|debiantion [~user@IGLD-84-229-82-231.inter.net.il] has quit [Quit: Leaving]
08:31|-|tycale [~tycale@55.79-244-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
08:31|-|tycale [~tycale@55.79-244-81.adsl-dyn.isp.belgacom.be] has joined #debian
08:34|-|jm_ [flier@mindwipe.org] has quit [Quit: leaving]
08:34|-|remy [~remy@ABordeaux-156-1-40-192.w86-217.abo.wanadoo.fr] has joined #debian
08:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
08:37|-|S4ph1r [~keving@p5B025609.dip.t-dialin.net] has joined #debian
08:41|-|S4ph1r [~keving@p5B025609.dip.t-dialin.net] has left #debian []
08:42|-|digerati [~digerati@203.84.180.110] has joined #debian
08:43|-|waa [~waa@220112.static.ctb.virtua.com.br] has joined #debian
08:43|-|digerati [~digerati@203.84.180.110] has quit []
08:44|-|sangeetha [~sangeetha@203.129.255.190] has quit [Quit: Leaving]
08:44|-|visik7 [~dksakd@aruba-122-211.aruba.unimo.it] has quit [Remote host closed the connection]
08:44|-|juliank [~juliank@Q7b7b.q.strato-dslnet.de] has joined #debian
08:48|-|panic0001 [~nico@213.200.99.158] has joined #debian
08:49|-|panic0001 [~nico@213.200.99.158] has left #debian []
08:49|-|donfede [~grauf@castor.rfa.org] has joined #debian
08:49|-|southernc [~southernc@c-71-235-120-220.hsd1.ma.comcast.net] has joined #debian
08:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
08:50<southernc>whats the command for apt-get to reinstall the configs ?
08:50<petemc>!confmiss
08:50<dpkg>the reason you have to use dpkg --force-confmiss is because whenever your config files are gone, dpkg assumes you deleted them on purpose, and that you want them to stay deleted. You can also reinstall them using the following apt-get line: apt-get -o DPkg::Options::="--force-confmiss" --reinstall install <packagename>
08:50<southernc>ty
08:50|-|eliadosom [~Herr@168.Red-83-32-165.dynamicIP.rima-tde.net] has joined #debian
08:50|-|southernc [~southernc@c-71-235-120-220.hsd1.ma.comcast.net] has quit []
08:58|-|Metalqga [~metalqga@cable-84-43-141-59.mnet.bg] has left #debian []
08:58|-|tycale_ [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
08:59|-|Cave [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has joined #debian
09:00|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has quit [Read error: Connection reset by peer]
09:02|-|tycale_ [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
09:02|-|visik7 [~dksakd@aruba-122-211.aruba.unimo.it] has joined #debian
09:02|-|tycale_ [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
09:02|-|tycale [~tycale@55.79-244-81.adsl-dyn.isp.belgacom.be] has quit [Ping timeout: 480 seconds]
09:04|-|snaj [~chatzilla@dsl-out.exorigo.pl] has quit [Ping timeout: 480 seconds]
09:05|-|debUsr42 [~sanctus@p54BA66FB.dip.t-dialin.net] has joined #debian
09:05|-|stoffe_ [~stoffe@c213-200-184-137.bredband.comhem.se] has joined #debian
09:05|-|stoffe_ [~stoffe@c213-200-184-137.bredband.comhem.se] has quit []
09:06|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
09:07|-|panic0001 [~nico@213.200.99.158] has joined #debian
09:07|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has quit [Quit: smeding go bye bye.]
09:07|-|panic0001 [~nico@213.200.99.158] has left #debian []
09:08|-|albert [~albert@e176005218.adsl.alicedsl.de] has quit [Quit: Leaving]
09:08|-|popeye [~fhwro@69.15.81.122] has joined #debian
09:12|-|debUsr42 [~sanctus@p54BA66FB.dip.t-dialin.net] has quit [Quit: Verlassend]
09:13<kop>What's the right way to set memory limits for my daemons? Manually hack the /etc/init.d/ scripts? (*bleh*)
09:14<kop>(That'd be to put ulimit commands in them.)
09:19|-|rmaj [~rmaj@bsa6.neoplus.adsl.tpnet.pl] has joined #debian
09:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
09:20<rmaj>hello
09:20|-|jack_wyt_ [~jack@124.64.111.214] has quit [Read error: Connection reset by peer]
09:20<rmaj>are you aware that polish fonts do not work in debian nor ubuntu for over a year?
09:20[~]rmaj is surprised noone fixes that
09:20<formorer>did you submitted a bug report?
09:24|-|jungla [utente@87.13.52.83] has joined #debian
09:25<jungla>hi, how can I start cupsd on startup?
09:25<rmaj>formorer: not yet, but its really strange, no one of thousad users did it?
09:25<rmaj>jungla: perhaps rcconf as root
09:25<formorer>dunno, I never used polish fonts :)
09:26|-|EtherNet [~EtherNet@OL240-101.fibertel.com.ar] has joined #debian
09:27<jungla>rmaj: tnks, but why it is not on the list?
09:29|-|jungla [utente@87.13.52.83] has quit []
09:29|-|Piet [~piet@tor.noreply.org] has quit [Ping timeout: 480 seconds]
09:30<rmaj>juliank: I dunno
09:31|-|H [~h@tor-irc.dnsbl.oftc.net] has quit [Quit: Konversation terminated!]
09:32|-|musis [~musis@189.12.159.199] has joined #debian
09:32|-|musis changed nick to hatoon
09:33|-|jungla [utente@87.13.52.83] has joined #debian
09:34|-|qbit [~abieber@inet-netcache2-o.oracle.com] has joined #debian
09:34<jungla>about cupsd, linking cupsd to init.d doesn't work, what should I link?
09:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
09:35<kop>jungla : /etc/init.d/cupsd (See also update-rc.d)
09:36|-|rickysarraf [~Rickyx@202.3.112.4] has quit [Ping timeout: 480 seconds]
09:36<kop>jungla : It might also have something to do with lpd for backwards compatibility....
09:36<jungla>ok, but it says something like: start is an invalid parameter, try -f to start on foreground
09:37|-|atperez [~atperez@200.95.226.21] has joined #debian
09:37|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has joined #debian
09:37|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has quit [Remote host closed the connection]
09:38<bcochofel>Hi, is there a way to put x-lite icon on the icon bar of fluxbox?
09:38<gsimmons>jungla: Do you have 'cupsys' installed? This would have provided you with /etc/init.d/cupsys.
09:38<kop>jungla : I'm running sarge, and have something called cupsys in /etc/init.d/ You'll just have to look at your /etc/init.d/ and perhaps read the desc at the top of the script.
09:39|-|visik7 [~dksakd@aruba-122-211.aruba.unimo.it] has quit [Remote host closed the connection]
09:39|-|emonge [~emonge@168.243.176.133] has joined #debian
09:39|-|noname001 [~pawel@82-32-102-47.cable.ubr01.hawk.blueyonder.co.uk] has joined #debian
09:39|-|Tombar_uy [~tombar@r201-221-43-157.dialup.adsl.anteldata.net.uy] has joined #debian
09:41|-|bibi___ [~nroche@62.147.190.218] has quit [Ping timeout: 480 seconds]
09:41|-|rzawutang44 [~guile@88.140.89.219] has left #debian [Konversation terminated!]
09:41<jungla>ok, I have cupsys, and it start on boot. It also contain path of cupsd...
09:42<jungla>nut I don't see cupsys on rcconf list
09:42<jungla>*but
09:44<tycale_>./aq2: error while loading shared libraries: libSDL-1.2.so.0: cannot open shared object file: No such file or directory
09:44|-|hatoon [~musis@189.12.159.199] has left #debian [Saindo]
09:45|-|sysop [~asturion@dsl-200-67-99-102.prod-empresarial.com.mx] has joined #debian
09:47|-|ranix [~ranix@ip70-181-21-68.ri.ri.cox.net] has joined #debian
09:48<ranix>Hey guys, I use SSH a lot, and I need my terminals to have Unicode support. Does anyone know of any X terminal emulators like aterm or eterm that have unicode support? Aterm/Eterm are useless to me, but I like the way they look and the things they do
09:49<stew>ranix: urxvt or uxterm
09:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
09:49<ranix>yeah I'm using uxterm now but it doesn't seem to do anything nifty like transparency or cool backgrounds
09:50|-|kmap [~kmap@barmen.interhost.no] has left #debian []
09:50|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has quit [Quit: Lämnar]
09:51<stew>ranix: iirc urxvt would do a background pixmap
09:52|-|Overfiend [~branden@cpe-65-29-71-69.indy.res.rr.com] has joined #debian
09:53<ranix>thanks Stew, rxvt might work
09:53|-|jungla [utente@87.13.52.83] has quit [Quit: Ex-Chat]
09:54|-|Dirtyworks [SouthernC@c-71-235-120-220.hsd1.ma.comcast.net] has joined #debian
09:54<Dirtyworks>anyone know how i can configure sendmail so that when i send an email out from my box through my isp's smtp server it shows up as username@mydomain.com and not root@isp.com
09:54<Dirtyworks>>
09:54<Dirtyworks>?
09:55|-|qeed [~qeed@adsl-210-31-93.mco.bellsouth.net] has joined #debian
09:56<Hotaru>Dirtyworks: masquerade_as ..
09:56<Hotaru>Dirtyworks: and genericstable
09:58|-|internet [~internet@cybermed3.unice.fr] has joined #debian
09:58<Dirtyworks>my masquerade_as is set to isp.net
09:59<ranix>rc urxvt would do a background pixmap
09:59<ranix>-:- Overfiend [~branden@cpe-65-29-71-69.indy.res.rr.com] has joined #debian
09:59<ranix><ranix> thanks Stew, rxvt might work
09:59<ranix>-:- SignOff jungla: #debian (Quit: Ex-Chat)
09:59|-|ranix kicked [#debian] debhelper [use the paster bot or #flood]
09:59|-|ranix [~ranix@ip70-181-21-68.ri.ri.cox.net] has joined #debian
10:03|-|visik7 [~dksakd@aruba-122-211.aruba.unimo.it] has joined #debian
10:03<piju>where can i suscribe debian mailing list ?
10:04<stew>piju: http://lists.debian.org
10:05|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
10:08|-|tycale_ [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
10:08|-|Moonman [~knoppix@vir91-3-82-235-77-231.fbx.proxad.net] has joined #debian
10:08|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
10:09|-|mode/#debian [+l 319] by debhelper
10:09|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
10:10|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
10:11|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
10:11|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
10:12|-|slaxz [~slaxz@p54B47957.dip.t-dialin.net] has joined #debian
10:13|-|Moonman [~knoppix@vir91-3-82-235-77-231.fbx.proxad.net] has left #debian []
10:13|-|Federico3 [~fede@tor-irc.dnsbl.oftc.net] has joined #debian
10:14<ranix>Does anyone know what the format for geometry is in rxvt's pixmap option?
10:14|-|guigah [login.net@201.11.196.235] has joined #debian
10:14|-|dds [~dds@h219-110-209-140.catv02.itscom.jp] has joined #debian
10:14<ranix>i.e. backgroundPixmap:path[;geometry]
10:14|-|guigah [login.net@201.11.196.235] has left #debian []
10:16|-|knoppix_ [~knoppix@211.54.209.205] has joined #debian
10:16|-|qeed [~qeed@adsl-210-31-93.mco.bellsouth.net] has quit [Ping timeout: 480 seconds]
10:17|-|knoppix_ [~knoppix@211.54.209.205] has quit []
10:17|-|deepak [~deepak@210.211.198.135] has joined #debian
10:18|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
10:18|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
10:18|-|ortrud [~ortrud@Q0feb.q.pppool.de] has joined #debian
10:19|-|qbit [~abieber@inet-netcache2-o.oracle.com] has quit [Quit: Lost terminal]
10:19|-|internet [~internet@cybermed3.unice.fr] has quit [Quit: Client Exiting]
10:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
10:19|-|die_z [~die_z@ip-115-150.adsl.cheapnet.it] has quit [Ping timeout: 480 seconds]
10:19|-|ortrud [~ortrud@Q0feb.q.pppool.de] has quit []
10:19|-|myles [~myles@CPE0050181121d5-CM0012254493da.cpe.net.cable.rogers.com] has joined #debian
10:19|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has joined #debian
10:22|-|lunatic [~francois@erlannic.irisa.fr] has left #debian [Leaving]
10:23|-|BluesKaj [~kaj@bas1-sudbury98-1177677386.dsl.bell.ca] has joined #debian
10:24|-|BluesKaj [~kaj@bas1-sudbury98-1177677386.dsl.bell.ca] has quit []
10:24|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
10:25|-|tuzhila [~tuzhila@83.143.152.216] has joined #debian
10:26|-|qeed [~qeed@adsl-146-70-47.mco.bellsouth.net] has joined #debian
10:27|-|Amorphous [jan@bras-co-85-197-0-240.westend.de] has quit [Quit: shutdown]
10:27|-|Guest51 [~JoY@85-18-71-186.ip.fastwebnet.it] has quit [Quit: Sto andando via]
10:28<ranix>exit
10:28<ranix>ahem
10:28<ranix>excuse
10:28|-|ranix [~ranix@ip70-181-21-68.ri.ri.cox.net] has quit [Quit: [BX] BitchX is as BitchX does]
10:28|-|Cav_ [~Cav@host86-152-74-94.range86-152.btcentralplus.com] has joined #debian
10:28[~]Federico3 trying /ahem and /excuse
10:28|-|die_z [~die_z@ip-115-150.adsl.cheapnet.it] has joined #debian
10:29|-|knoppix_ [~knoppix@c-75-69-157-167.hsd1.nh.comcast.net] has joined #debian
10:29|-|knoppix_ [~knoppix@c-75-69-157-167.hsd1.nh.comcast.net] has quit []
10:30|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has joined #debian
10:30|-|amit [~amit@il.qumranet.com] has joined #debian
10:31|-|Web-sidux715 [~bb@dslb-088-072-208-079.pools.arcor-ip.net] has quit [Remote host closed the connection]
10:32|-|linux-fox [~linux-fox@60.218.58.70] has quit [Quit: Leaving]
10:32|-|rmaj [~rmaj@bsa6.neoplus.adsl.tpnet.pl] has left #debian [see you later]
10:34|-|ewanm89 [~ewanm89@host81-159-254-36.range81-159.btcentralplus.com] has joined #debian
10:34|-|ewanm89 changed nick to ewanm89_laptop
10:34|-|sindre [~sindre@3.84-49-134.nextgentel.com] has quit [Read error: Connection reset by peer]
10:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
10:36|-|bighornram [~jeff@71.39.34.171] has joined #debian
10:37|-|rob33n [~rob33n@88.245.251.222] has joined #debian
10:38|-|kayoz [~kayoz@dslb-088-065-243-215.pools.arcor-ip.net] has joined #debian
10:38|-|kayoz [~kayoz@dslb-088-065-243-215.pools.arcor-ip.net] has quit []
10:39|-|qbit [~abieber@inet-netcache3-o.oracle.com] has joined #debian
10:39|-|bcochofel [~bcochofel@adonis.iportalmais.pt] has quit [Quit: leaving]
10:41|-|wolog [~wolog@lns-bzn-40-82-251-185-243.adsl.proxad.net] has joined #debian
10:42|-|kurumin [~kurumin@201.22.73.197.adsl.gvt.net.br] has joined #debian
10:42|-|bighornram [~jeff@71.39.34.171] has quit [Quit: using sirc version 2.211+KSIRC/1.3.12]
10:43|-|kurumin changed nick to joaojbarros
10:43|-|deepak [~deepak@210.211.198.135] has quit [Quit: Leaving]
10:43|-|qbit [~abieber@inet-netcache3-o.oracle.com] has quit []
10:43|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
10:44|-|remy_ [~remy@ABordeaux-156-1-93-140.w90-5.abo.wanadoo.fr] has joined #debian
10:44|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has quit [Quit: Client exiting]
10:45|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has joined #debian
10:45|-|Lohrun [~chatzilla@crock.sp2mi.univ-poitiers.fr] has quit [Quit: ChatZilla 0.9.78.1 [Firefox 2.0.0.5/2007071317]]
10:46<joaojbarros>tem alguem que fala portugues ai??????
10:47|-|remy__ [~remy@ABordeaux-156-1-121-72.w90-5.abo.wanadoo.fr] has joined #debian
10:47|-|kart_ [kartikm@59.161.12.91] has joined #debian
10:47<Ganneff>!pt
10:47<dpkg>Esse canal e apenas em ingles. Por favor, use #debian-br (/j #debian-br) para ajuda em portugues.
10:47|-|emonge [~emonge@168.243.176.133] has quit [Quit: That's all for now, folks]
10:47|-|qbit [~abieber@inet-netcache3-o.oracle.com] has joined #debian
10:48|-|joaojbarros [~kurumin@201.22.73.197.adsl.gvt.net.br] has quit [Quit: Konversation terminated!]
10:48|-|Amorphous [jan@bras-co-85-197-0-240.westend.de] has joined #debian
10:48|-|tycale_ [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
10:49|-|Cav_ [~Cav@host86-152-74-94.range86-152.btcentralplus.com] has quit [Quit: Cav_]
10:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
10:49|-|remy [~remy@ABordeaux-156-1-40-192.w86-217.abo.wanadoo.fr] has quit [Ping timeout: 480 seconds]
10:50|-|Requiem [kc@c-67-186-239-161.hsd1.ut.comcast.net] has joined #debian
10:53|-|remy_ [~remy@ABordeaux-156-1-93-140.w90-5.abo.wanadoo.fr] has quit [Ping timeout: 480 seconds]
10:54|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Ping timeout: 480 seconds]
10:54|-|Drago84 [~Drago84@host222-16-dynamic.17-87-r.retail.telecomitalia.it] has joined #debian
10:54|-|Drago84 [~Drago84@host222-16-dynamic.17-87-r.retail.telecomitalia.it] has quit []
10:55|-|Smooph [~Smooph@e180133132.adsl.alicedsl.de] has joined #debian
10:56|-|remy__ [~remy@ABordeaux-156-1-121-72.w90-5.abo.wanadoo.fr] has quit [Ping timeout: 480 seconds]
10:56|-|amit [~amit@il.qumranet.com] has quit [Read error: Connection reset by peer]
10:56|-|remy [~remy@ABordeaux-156-1-149-196.w90-5.abo.wanadoo.fr] has joined #debian
10:57|-|binary [~binary@222.219.132.42] has joined #debian
10:58|-|jae [~jae@d253028.dialin.hansenet.de] has joined #debian
10:58|-|valdyn [~valdyn@ppp-88-217-18-116.dynamic.mnet-online.de] has quit [Quit: leaving]
10:59|-|wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has quit [Quit: Leaving]
10:59|-|rob33n [~rob33n@88.245.251.222] has left #debian [gelicem..]
10:59|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
11:01|-|kylix [~Espiral@227.Red-83-35-19.dynamicIP.rima-tde.net] has joined #debian
11:01|-|kylix [~Espiral@227.Red-83-35-19.dynamicIP.rima-tde.net] has left #debian []
11:05|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
11:05|-|binary [~binary@222.219.132.42] has quit [Quit: Leaving]
11:07|-|binary [~binary@222.219.132.42] has joined #debian
11:07|-|Sub-Zero [~desk@190.72.134.100] has quit [Quit: Bond^Script † By: ^Bond007^† www.BondScript.tk]
11:09<|dennis|>Greetings: before install begins, is there an option i can pass to the installer ,for it to not to use debian's default security.debian.org server for security updates, i want it to use my own internal one, we have over 100 machines, and going to the web to download every time is eating bandwidth..
11:10|-|visik7 [~dksakd@aruba-122-211.aruba.unimo.it] has quit [Quit: Ex-Chat]
11:11|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has quit [Quit: Leaving]
11:11<|dennis|>i tried editing the sources.list file under the /target/etc/apt fs but looks like it loads that info before..
11:11|-|Optical [~dlz@248.35.188.60.broad.tz.zj.dynamic.163data.com.cn] has quit [Quit: Wave~~]
11:14|-|Smooph [~Smooph@e180133132.adsl.alicedsl.de] has quit [Quit: Kopete 0.11.1 : http://kopete.kde.org]
11:15|-|kart_ [kartikm@59.161.12.91] has quit [Quit: \|-_-|/]
11:15|-|vicente [~vicente@249.pool85-60-52.dynamic.orange.es] has joined #debian
11:16|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has joined #debian
11:16|-|vicente [~vicente@249.pool85-60-52.dynamic.orange.es] has quit []
11:17|-|die_z [~die_z@ip-115-150.adsl.cheapnet.it] has quit [Quit: cya soon!]
11:18|-|tycale_ [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Read error: No route to host]
11:18|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has joined #debian
11:18|-|kmap [~kmap@barmen.interhost.no] has joined #debian
11:20|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has quit [Remote host closed the connection]
11:20|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
11:21|-|binary [~binary@222.219.132.42] has quit [Quit: Leaving]
11:22|-|Cave changed nick to Cave`
11:22|-|fxiny [~fxiny@82.52.16.60] has joined #debian
11:23|-|dwon [~dwon@static24-89-65-166.regina.accesscomm.ca] has joined #debian
11:23|-|luo [~binluo@222.219.132.42] has joined #debian
11:23|-|schoinobates [~lmamane@capsaicin.mamane.lu] has joined #debian
11:23|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has quit [Remote host closed the connection]
11:24|-|dwon [~dwon@static24-89-65-166.regina.accesscomm.ca] has quit []
11:24|-|dwon [~dwon@static24-89-65-166.regina.accesscomm.ca] has joined #debian
11:25|-|rickysarraf [~Rickyx@202.3.112.4] has joined #debian
11:26|-|khadim [~khadim@196.207.234.93] has joined #debian
11:26|-|tycale [~tycale@106.88-241-81.adsl-dyn.isp.belgacom.be] has quit [Remote host closed the connection]
11:26|-|khadim changed nick to diambadie
11:28|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
11:29|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has left #debian []
11:29|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
11:30|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has left #debian []
11:30|-|wlue [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
11:30|-|wlue [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has left #debian []
11:31|-|piju [~piju@magnifix.com.my] has quit [Remote host closed the connection]
11:31|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
11:31|-|diambadie [~khadim@196.207.234.93] has quit [Quit: Ex-Chat]
11:31|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has left #debian []
11:32|-|valdyn [~valdyn@ppp-88-217-12-154.dynamic.mnet-online.de] has joined #debian
11:32|-|magnetic [~magnetic@14.Red-88-26-177.staticIP.rima-tde.net] has joined #debian
11:32|-|rickysarraf [~Rickyx@202.3.112.4] has quit [Read error: Connection reset by peer]
11:34|-|chrille_ [~chrille@p549D7FFE.dip.t-dialin.net] has joined #debian
11:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
11:35|-|chrille_ [~chrille@p549D7FFE.dip.t-dialin.net] has quit [Remote host closed the connection]
11:36|-|foolano [~magnetic@14.Red-88-26-177.staticIP.rima-tde.net] has quit [Ping timeout: 480 seconds]
11:36|-|alephnull [~alok@122.167.234.55] has joined #debian
11:37|-|Atomo64 [~Atomo64@200.92.151.48] has joined #debian
11:37|-|Trashynovel [~Rubbishbo@145.175.adsl.brightview.com] has joined #debian
11:38|-|luo [~binluo@222.219.132.42] has left #debian [Leaving]
11:40|-|slaxz [~slaxz@p54B47957.dip.t-dialin.net] has quit []
11:41|-|abeld [abeld@wat9378uw9.adsl.datanet.hu] has joined #debian
11:41|-|tuzhila [~tuzhila@83.143.152.216] has quit [Read error: Connection reset by peer]
11:41|-|Dirtyworks [SouthernC@c-71-235-120-220.hsd1.ma.comcast.net] has quit [Read error: Connection reset by peer]
11:43|-|Rajohan`Linux [~rajohan@ti231210a080-7181.bb.online.no] has quit [Ping timeout: 480 seconds]
11:43|-|dds [~dds@h219-110-209-140.catv02.itscom.jp] has quit [Ping timeout: 480 seconds]
11:45<abeld>Hi! I have a new install of etch on hdc2. In /boot/grub/menu.lst the correspoding line says "root (hd1,1)". The output of "grub-install /dev/hda" contains "(hd1) /dev/hdc". However, grub will only boot if I manually correct (hd1,1) to (hd0,1). Any ideas what might be causing this?
11:46<valdyn>abeld: do a --recheck
11:46<valdyn>abeld: grub-install --recheck
11:46|-|naudiz [~naudiz@thrall-gw.warwick.net] has joined #debian
11:48<naudiz>Should I install package updates that are not authenticated ? Is that too much of a security risk ?
11:48<abeld>doing "grub-install --recheck /dev/hda" shows "(hd1) /dev/hdc" and /dev/hda as (hd0) (as expected). What should I do next?
11:49|-|alexou [~toto@77.200.127.86] has joined #debian
11:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
11:49|-|alexou [~toto@77.200.127.86] has quit []
11:50|-|manphiz [dxy@218.244.247.198] has quit [Quit: Leaving]
11:51|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has joined #debian
11:52<miksuh>naudiz: updates? you have installed something already then?
11:53|-|Eulex [~alex@85.235.5.1] has quit [Remote host closed the connection]
11:53|-|madroach [madroach.d@p5B11B76C.dip0.t-ipconnect.de] has joined #debian
11:53<Wei>hi, guys, i am new with irc, so can anyone tell me, how can i list the servers with command? thanks
11:54<miksuh>do you mean channels?
11:54<miksuh>you can't list irc-servers
11:54<Wei>ok, thanks, miksuh
11:54<Wei>i mean irc-servers
11:54<naudiz>miksuh: no I didn't install the updates yet -- they could contain malicious code since it's not authenticated
11:55|-|Eulex [~alex@85.235.5.14] has joined #debian
11:55<miksuh>Wei: you can't do that
11:55<Wei>o ja
11:56<abeld>valdyn, any other ideas?
11:56<miksuh>naudiz: yeah but you have installed earlier version, if you are now updating something?
11:57|-|alexou [~toto@77.200.127.86] has joined #debian
11:57<alexou>hello
11:57|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has quit [Quit: Leaving]
11:57<naudiz>gnome shows automatic updates as an orange square with a star in the middle it says I have 20 updates waiting
11:57<naudiz>miksuh
11:58|-|alexou [~toto@77.200.127.86] has quit []
11:59|-|mode/#debian [+l 313] by debhelper
11:59|-|alexou [~toto@77.200.127.86] has joined #debian
12:00|-|nomadium [~miguel@190.72.184.29] has joined #debian
12:00|-|freezombie [someone@pD9E3231E.dip.t-dialin.net] has joined #debian
12:04|-|visik7 [~dksakd@host186-140-dynamic.58-82-r.retail.telecomitalia.it] has joined #debian
12:04|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has joined #debian
12:05|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
12:06|-|klMo [~mo@85.178.195.154] has joined #debian
12:06|-|SamuraiDio [~diovani@201-89-139-94.paebv701.dsl.brasiltelecom.net.br] has left #debian [visitem/leiam: http://the.blog.br/samuraidio]
12:07|-|free-zombie [someone@pD9E32054.dip.t-dialin.net] has quit [Ping timeout: 480 seconds]
12:08|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has quit [Ping timeout: 480 seconds]
12:12|-|madroach [madroach.d@p5B11B76C.dip0.t-ipconnect.de] has quit [Quit: Leaving]
12:12|-|donfede [~grauf@castor.rfa.org] has quit [Quit: Leaving.]
12:13|-|abeld [abeld@wat9378uw9.adsl.datanet.hu] has quit [Quit: Leaving]
12:13|-|jomacasbri [~jomacasbr@83.230.235.253] has joined #debian
12:14|-|jomacasbri [~jomacasbr@83.230.235.253] has quit []
12:15|-|alexou [~toto@77.200.127.86] has quit [Quit: Quitte]
12:16|-|dinah_ronja [~Ronja@dslb-084-056-239-189.pools.arcor-ip.net] has joined #debian
12:17<dinah_ronja>hiiiiiiiiiiiiiiiii
12:17<dinah_ronja>haöö
12:17<dinah_ronja>hallo ist da jemandß
12:17|-|naudiz_ [~naudiz@thrall-gw.warwick.net] has joined #debian
12:17<dinah_ronja>hhhi
12:18<dinah_ronja>wie gehts?
12:18|-|naudiz [~naudiz@thrall-gw.warwick.net] has quit [Ping timeout: 480 seconds]
12:18|-|ronja_dinah [~Ronja@dslb-084-056-239-189.pools.arcor-ip.net] has joined #debian
12:18|-|varka [~varkatope@p54A5EF44.dip.t-dialin.net] has quit [Quit: took the red pill...]
12:19<ronja_dinah>hello where are here?
12:19<ronja_dinah>wer isch do?
12:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
12:19|-|eisen [~eisen@xdsl-87-78-79-170.netcologne.de] has joined #debian
12:19<ronja_dinah>ji
12:19<ronja_dinah>hi
12:19<ronja_dinah>hallo???
12:20|-|ewanm89 [~ewanm89@host86-151-100-255.range86-151.btcentralplus.com] has joined #debian
12:21<stew>!de
12:21<dpkg>de is probably deutschsprachige Hilfe bekommt ihr in #debian.de (auf irc.oftc.net und irc.freenode.net) - German speaking users please go to #debian.de (on irc.oftc.net and freenode)
12:21|-|johnh [~johnh@rrcs-71-41-80-18.se.biz.rr.com] has joined #debian
12:21|-|ronja_dinah [~Ronja@dslb-084-056-239-189.pools.arcor-ip.net] has quit []
12:21|-|dinah_ronja [~Ronja@dslb-084-056-239-189.pools.arcor-ip.net] has quit []
12:21<stew>ronja_dinah: if you have a debian related question to ask in english, just ask. if you want to speak german, go to #debian.de
12:21|-|Wei [~wlue@IMG2.MiGen.Bio.Uni-Goettingen.de] has quit [Quit: Leaving]
12:21|-|debiantion [~user@IGLD-84-229-82-231.inter.net.il] has joined #debian
12:23|-|ths_ [~ths@ip-83-99-92-198.dyn.luxdsl.pt.lu] has joined #debian
12:23|-|oz [~oz@ABayonne-157-1-133-16.w90-16.abo.wanadoo.fr] has joined #debian
12:23|-|oz changed nick to Guest76
12:24<Guest76>!fr
12:24<dpkg>Pour l'aide en francais, veuillez aller aux canaux #debian-fr sur irc.debian.org ou irc.freenode.net. French users: for help in french, please go to #debian-fr on irc.debian.org or irc.freenode.net.
12:24|-|Guest76 changed nick to Oz``
12:25|-|kalle44 [~kalle44@dslb-082-083-237-078.pools.arcor-ip.net] has joined #debian
12:26|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has joined #debian
12:26<Cave`>!dk
12:26<dpkg>somebody said dk was Hvis du vil tale dansk og få hjælp til debian, skriv /join #linux.dk in your irc client, also the country Denmark
12:26|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has joined #debian
12:27|-|Cave` changed nick to Cave
12:27|-|Eulex [~alex@85.235.5.14] has quit [Remote host closed the connection]
12:27|-|ewanm89_laptop [~ewanm89@host81-159-254-36.range81-159.btcentralplus.com] has quit [Ping timeout: 480 seconds]
12:27|-|ewanm89 changed nick to ewanm89_laptop
12:27<debiantion>!say a
12:27<dpkg>a
12:30|-|naudiz_ [~naudiz@thrall-gw.warwick.net] has quit [Quit: Lost terminal]
12:35|-|joelfranco [~joel@cps.oryonsystems.com.br] has joined #debian
12:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
12:36|-|shogunx [~shogunx@rrcs-71-41-232-12.se.biz.rr.com] has joined #debian
12:37|-|alephnull [~alok@122.167.234.55] has quit [Quit: Bye all]
12:38|-|madroach [madroach.d@p5B11B76C.dip0.t-ipconnect.de] has joined #debian
12:39|-|mode/#debian [+l 319] by debhelper
12:40|-|pythbot1992364 [~pythbot19@84.229.82.231] has joined #debian
12:40|-|CloseCall [~avdongen@5352553A.cable.casema.nl] has joined #debian
12:40<CloseCall>wasabi!
12:41<debiantion>!say hello i'm a bot :)
12:41<dpkg>hello i'm a bot :)
12:41<pythbot1992364>hello i'm a bot :)
12:41<debiantion>hehe
12:41<jakeriver>plz :)
12:41<CloseCall>small question, who can i see which glib version i am using ?
12:41<debiantion>!quit
12:41<dpkg>try /quit
12:41|-|pythbot1992364 [~pythbot19@84.229.82.231] has quit [Remote host closed the connection]
12:41|-|kanru [~kanru@2001:5c0:8fff:fffe::69ab] has joined #debian
12:41<debiantion>its alive!!
12:41<debiantion>:)
12:41<kmap>CloseCall: dpkg -l libglib2.0-0
12:42|-|Rajohan`Linux [~Rajohan@ti231210a080-7181.bb.online.no] has joined #debian
12:42|-|snowball_ [~snowball@nly93-1-82-232-72-199.fbx.proxad.net] has joined #debian
12:42<CloseCall>thnx!
12:43|-|CloseCall [~avdongen@5352553A.cable.casema.nl] has quit []
12:43<kmap>CloseCall: Welcome. pkg-config is the more elegant distro independent way, but I forgot how to use it
12:43|-|CloseCall [~avdongen@5352553A.cable.casema.nl] has joined #debian
12:44|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has quit [Quit: smeding go bye bye.]
12:44|-|CloseCall [~avdongen@5352553A.cable.casema.nl] has quit []
12:44|-|CloseCall [~avdongen@5352553A.cable.casema.nl] has joined #debian
12:45|-|CloseCall [~avdongen@5352553A.cable.casema.nl] has quit []
12:45|-|kurumin [~kurumin@201.10.72.251] has joined #debian
12:46<kurumin>google talk
12:46<debiantion>!help
12:46|-|lambda [~lambda@84.7.112.88] has quit [Ping timeout: 480 seconds]
12:46|-|kurumin [~kurumin@201.10.72.251] has quit []
12:47|-|kurumin [~kurumin@201009179012.user.veloxzone.com.br] has joined #debian
12:47<kurumin>join #sexo
12:47<kurumin>#sexo
12:48|-|tuzhila [~tuzhila@83.143.152.216] has joined #debian
12:50|-|kurumin [~kurumin@201009179012.user.veloxzone.com.br] has quit [Remote host closed the connection]
12:53|-|joelfranco [~joel@cps.oryonsystems.com.br] has left #debian [Fui embora]
12:54|-|themill [~stuart@phoenix.chm.bris.ac.uk] has quit [Ping timeout: 480 seconds]
12:56|-|lambda [~lambda@88-138-52-236.adslgp.cegetel.net] has joined #debian
12:56|-|kalle44 [~kalle44@dslb-082-083-237-078.pools.arcor-ip.net] has quit [Quit: Verlassend]
12:57|-|kurtosis [~kurtosis@zue-tix-bbcs-dynip-173-154.vtx.ch] has joined #debian
12:58|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has joined #debian
12:58<debiantion> why sending "QUIT bye\r\n" to the server is not working?
12:58|-|kurtosis [~kurtosis@zue-tix-bbcs-dynip-173-154.vtx.ch] has left #debian []
12:59<EmleyMoor>My keyboard no longer types the English pound sign in xterms and OpenOffice - though I find I can still type it in qemus, I only get a 3 in xterms and OpenOffice
12:59<EmleyMoor>Why would that be?
13:00<mjk>EmleyMoor: Is that the only key affected?
13:00<EmleyMoor>It certainly seems to be the only key affected
13:00|-|guillaume [~guillaume@57.164.101-84.rev.gaoland.net] has joined #debian
13:01|-|albert [~albert@85.176.8.39] has joined #debian
13:01<guillaume>hello all, anyone can help me with glx pb under nvidia prorpietary driver with lenny ?
13:01<EmleyMoor>Ah, another key is affected - the backtick key no longer gives its shifted character either
13:02<mjk>EmleyMoor: Could be a different keymap the major difference of which are these two keys.
13:03<EmleyMoor>mjk: I'd like to try outside X but for some reason I can't switch out either
13:03<mjk>Hmm ... I can only find /etc/console/boottime.kmap.gz
13:03<mjk>EmleyMoor: Ctrl-Alt-Fn doesn't work?
13:03|-|alexou [~toto@77.200.127.86] has joined #debian
13:04<EmleyMoor>No, it doesn't - it generates characters rather than switching
13:04|-|alexou [~toto@77.200.127.86] has quit []
13:04<udo>!es
13:04<dpkg>Hispanohablantes: Por favor usen #debian-es, alli obtendran mas ayuda. Spanish Speakers: Please use #debian-es, there you will get much more help.
13:04<mjk>EmleyMoor: As root, "chvt <console number>" would work.
13:04<mjk>EmleyMoor: You should have a look in /etc/X11/xorg.conf
13:05<mjk>EmleyMoor: Section "InputDevice", Driver "kbd". There's the keyboard model and layout.
13:05<EmleyMoor>I get pound signs OK there
13:05|-|slaxz [~slaxz@p54B47957.dip.t-dialin.net] has joined #debian
13:05<mjk>EmleyMoor: Okay, it's most likely xorg.conf, I think.
13:06|-|azorg [~azorg@87.245.133.19] has joined #debian
13:06|-|sd2 [~beloved@241-177.static.alkar.net] has joined #debian
13:06<EmleyMoor>Could having one letter the wrong case in the XkbLayout setting cause it?
13:07<mjk>EmleyMoor: Possibly, I don't know. I have "de" as layout, so I'd suggest lower-case only.
13:07|-|ranix [~ranix@ip70-181-21-68.ri.ri.cox.net] has joined #debian
13:07<EmleyMoor>I had uK for some reason... have changed it to uk and will bring it into effect next time I'm not doing anything it will affect
13:07<mjk>EmleyMoor: I'd even say: Very likely, because the layout name is probably part of a keyboard map file name, and Linux FSs are case-sensitive.
13:07<EmleyMoor>XkbRules should be xorg, yes?
13:07|-|Mo [~mo@e178246131.adsl.alicedsl.de] has joined #debian
13:08<mjk>EmleyMoor: At least that's what I got.
13:08<mjk>EmleyMoor: XkbModel is pc102 here.
13:08<EmleyMoor>pc105 is right for this one
13:08<mjk>EmleyMoor: If you have a Windows keyboard, it's probably pc104 or pc105.
13:09|-|mode/#debian [+l 327] by debhelper
13:09|-|jhiujhiu [~sdsdasda@host254-140-dynamic.55-82-r.retail.telecomitalia.it] has joined #debian
13:09|-|Mo [~mo@e178246131.adsl.alicedsl.de] has quit []
13:09<ranix>so I'm running exim4, and it's logging about 10 days worth of logs in /var/log/exim4/. I would prefer it log 20 days, but I can't for the life of me find any information about how to change the preservation of log files for exim4. How do I increase the number of saved logs in /var/log/exim4 from 10 days to 20 days?
13:09|-|DocTrax [~PHP@p5B12C1F4.dip0.t-ipconnect.de] has joined #debian
13:09|-|Mo [~mo@e178246131.adsl.alicedsl.de] has joined #debian
13:09|-|arato [~arato@S01060018f857ee67.ed.shawcable.net] has joined #debian
13:09|-|albert [~albert@85.176.8.39] has quit [Remote host closed the connection]
13:10|-|klMo [~mo@85.178.195.154] has quit [Ping timeout: 480 seconds]
13:12|-|sysop [~asturion@dsl-200-67-99-102.prod-empresarial.com.mx] has quit [Ping timeout: 480 seconds]
13:12|-|Cave_ [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has joined #debian
13:12|-|tycale [~tycale@242.67-244-81.adsl-dyn.isp.belgacom.be] has joined #debian
13:12|-|ROOTweiller [~deblfpser@200.109.134.245] has quit [Ping timeout: 480 seconds]
13:12|-|ths_ [~ths@ip-83-99-92-198.dyn.luxdsl.pt.lu] has quit [Quit: Leaving]
13:13|-|knoppix_ [~knoppix@cpe-76-169-98-37.socal.res.rr.com] has joined #debian
13:13<knoppix_>hi
13:13<mjk>Bad nick for this channel. ;-)
13:13|-|knoppix_ changed nick to Guest78
13:14<Guest78>didn't look at it
13:14<mjk>=)
13:14|-|madroach [madroach.d@p5B11B76C.dip0.t-ipconnect.de] has quit [Quit: Leaving]
13:15|-|Federico3 [~fede@tor-irc.dnsbl.oftc.net] has quit [Quit: Leaving]
13:15|-|sysop [~asturion@dsl-200-67-99-102.prod-empresarial.com.mx] has joined #debian
13:15<Guest78>my new grfix card works with Knopix would it work on debian as well
13:16|-|Cave [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has quit [Ping timeout: 480 seconds]
13:16<guillaume>Guest78: what's your card ?
13:16<Guest78>???
13:16<EmleyMoor>Guest78: It ought but what is it?
13:16<Guest78>ati radion x1550
13:17|-|GhostlyDeath [~ghostlyde@ool-44c5a585.dyn.optonline.net] has quit [Ping timeout: 480 seconds]
13:17|-|loscarse [~loscarse@host14-114-dynamic.57-82-r.retail.telecomitalia.it] has joined #debian
13:17|-|jean [~kurumin@201.78.5.135] has joined #debian
13:17|-|loscarse [~loscarse@host14-114-dynamic.57-82-r.retail.telecomitalia.it] has quit []
13:18<jean>boa tarde
13:18<mjk>!br
13:18<dpkg>Este canal é apenas em inglês. Por favor, use #debian-br (/j #debian-br) para ajuda em portugues.
13:18<mjk>(Just a guess)
13:18|-|jean [~kurumin@201.78.5.135] has quit []
13:19|-|jhiujhiu [~sdsdasda@host254-140-dynamic.55-82-r.retail.telecomitalia.it] has quit [Read error: Connection reset by peer]
13:19<fxiny>hmmm ;)
13:19|-|Guest78 [~knoppix@cpe-76-169-98-37.socal.res.rr.com] has quit [Quit: Leaving]
13:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
13:19|-|tralala_ [~joro@athedsl-250168.home.otenet.gr] has joined #debian
13:22|-|dondelelcaro [~don@archimedes.ucr.edu] has quit [Ping timeout: 480 seconds]
13:22|-|tralala [~joro@85.72.67.149] has quit [Ping timeout: 480 seconds]
13:23<fxiny>oh nice : icewilly fix upgrade
13:23|-|kanru [~kanru@2001:5c0:8fff:fffe::69ab] has quit [Quit: Leaving]
13:23|-|sysop [~asturion@dsl-200-67-99-102.prod-empresarial.com.mx] has quit [Ping timeout: 480 seconds]
13:25|-|dondelelcaro [~don@archimedes.ucr.edu] has joined #debian
13:26|-|donfed1 [~grauf@castor.rfa.org] has joined #debian
13:29|-|mode/#debian [+l 321] by debhelper
13:29|-|sysop [~asturion@dsl-200-67-99-102.prod-empresarial.com.mx] has joined #debian
13:30|-|caio [~caio@boca.4linux.com.br] has joined #debian
13:31<caio>oi
13:31|-|valdyn_ [~valdyn@ppp-88-217-21-158.dynamic.mnet-online.de] has joined #debian
13:31<mjk>!br
13:31<dpkg>Este canal é apenas em inglês. Por favor, use #debian-br (/j #debian-br) para ajuda em portugues.
13:31<caio>hi
13:31<mjk>:-)
13:31<fxiny>that was too easy :)
13:31<mjk>fxiny: ;-)
13:31<caio>sorry
13:31<mjk>caio: No problem.
13:31<caio>ok
13:31<EmleyMoor>I'd like to change over from what I'm currently using to the standard Gnome desktop sometime but that's a project for later I guess
13:31|-|Tombar_uy [~tombar@r201-221-43-157.dialup.adsl.anteldata.net.uy] has quit [Remote host closed the connection]
13:31|-|Fattihvalos [~fader@0x5550acb4.adsl.cybercity.dk] has joined #debian
13:32<Fattihvalos>evening people
13:32<mjk>evening
13:32|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has joined #debian
13:33|-|valdyn [~valdyn@ppp-88-217-12-154.dynamic.mnet-online.de] has quit [Ping timeout: 480 seconds]
13:33|-|valdyn_ changed nick to valdyn
13:33|-|kurumin [~kurumin@200.99.40.190] has joined #debian
13:33|-|kurumin [~kurumin@200.99.40.190] has quit []
13:34|-|Metalqga [~metalqga@cable-84-43-141-59.mnet.bg] has joined #debian
13:35<fxiny>what ? am i running xmms2 gonzo ?
13:35<qbit>gonzo?
13:35|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
13:35<fxiny>i think i'm running gonzo : there is no compilation cli
13:36<fxiny>i want : jekyll
13:37|-|guillaume [~guillaume@57.164.101-84.rev.gaoland.net] has quit [Quit: guillaume]
13:37|-|berto [~berto@fanzine.igalia.com] has quit [Quit: Lost terminal]
13:37<Fattihvalos>question: i just succeeded in install debian base system (go me) no x... how do i get on IRC?
13:38|-|bruno-oliveira [~bggo@boca.4linux.com.br] has joined #debian
13:38|-|Glenn^BF [~fburlet@user-85-201-8-232.tvcablenet.be] has joined #debian
13:38|-|Althaser [~GNU@bl9-252-231.dsl.telepac.pt] has quit [Ping timeout: 480 seconds]
13:38|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has quit [Ping timeout: 480 seconds]
13:38<suiside>Fattihvalos: by using irssi for example
13:38|-|bruno-oliveira changed nick to bggo
13:38<EmleyMoor>Fattihvalos: Install an IRC client - like irssi for example
13:38|-|bggo [~bggo@boca.4linux.com.br] has quit []
13:39<Fattihvalos>right... can i do this while im perfoming other operations like opening a new konsol inx
13:39<Fattihvalos>in x
13:40<fxiny>qbit: three flavours , all Dr : Dr.Gonzo Dr.House and Dr.Jekyll
13:40|-|sysop [~asturion@dsl-200-67-99-102.prod-empresarial.com.mx] has quit [Ping timeout: 480 seconds]
13:41<EmleyMoor>Fattihvalos: Certainly... run aptitude in an xterm
13:41<Fattihvalos>uhm linux noob here could you elaborate?
13:41<qbit>fxiny, pwhao
13:41<fxiny>Fattihvalos: don't listen to them : just install irssi
13:41<fxiny>:)
13:42<EmleyMoor>Fattihvalos: Running an xterm (or gnome-terminal) is how you do command line stuff in a window in X
13:42<fxiny>qbit: xmms2 rocks
13:42<EmleyMoor>If you run aptitude, you can search its list for irssi and select it...
13:43<qbit>fxiny, have you used amarok?
13:43|-|atperez [~atperez@200.95.226.21] has quit [Quit: Ya me voy, ya me despido. Cuídense y hasta pronto.]
13:43<qbit>i hate it... more than anything ... but it works the best for me
13:43<Fattihvalos>yeah.. but i dont have X installed im running pure text... and atm im installing packages can i somehow open another terminal and install irssi from hter
13:43<EmleyMoor>I find Amarok quite good
13:43<Fattihvalos>there
13:43<EmleyMoor>I used to use zinf
13:43<EmleyMoor>Fattihvalos: If you are installing packages, no - you will have to wait
13:44<EmleyMoor>(unless you picked irssi as one of them anyway)
13:44|-|Fjordside [~JMF@90.185.54.203] has quit [Read error: Connection reset by peer]
13:44<qbit>hate!
13:44<suiside>Fattihvalos: press alt and F'key (F2, F3, F4 etc) to jump to anotherher tty, but you can't have more that one aptitude/apt-get running at once
13:44<suiside>*another
13:45|-|Rubbishbook [~rubbishbo@user-5af19105.tcl110.dsl.pol.co.uk] has joined #debian
13:45<caio>It forgives to ask, but somebody uses bacula backup?
13:45|-|tcsetattr [pacman@dialup-4.224.135.198.Dial1.Cincinnati1.Level3.net] has joined #debian
13:45<Fattihvalos>thanks folks that cleared up a bit :)
13:45|-|ibu [~ibu@e180229232.adsl.alicedsl.de] has quit [Ping timeout: 480 seconds]
13:46|-|Bggo [~bggo@boca.4linux.com.br] has joined #debian
13:46|-|TumaT [~suporte@201.29.39.34] has joined #debian
13:46|-|sysop [~asturion@189.192.8.98] has joined #debian
13:46<qbit>fxiny, what front end do you use?
13:46<qbit>for xmms2
13:46<TumaT>Alguem pode me tirar umas duvidas sobre alterar uma distro?
13:47<fxiny>qbit: yes , is ok but is too heavy . i was qyerying medialib.db to see how it classify collections
13:47<fxiny>qbit: front ends ? plain xmms2 , mysql3 cli , nyello and gxmms2
13:47<caio>www.google.com/linux
13:47<fxiny>sorry : sql3 lite
13:48<mjk>TumaT: English, please.
13:48<stew>!br
13:48<dpkg>Este canal é apenas em inglês. Por favor, use #debian-br (/j #debian-br) para ajuda em portugues.
13:48<fxiny>qbit: Jekyill seems more advanced
13:48|-|caio [~caio@boca.4linux.com.br] has quit [Quit: Saindo]
13:48|-|Bggo [~bggo@boca.4linux.com.br] has quit []
13:48<TumaT>sorry...
13:48|-|valdyn [~valdyn@ppp-88-217-21-158.dynamic.mnet-online.de] has quit [Read error: Connection reset by peer]
13:48<TumaT>i forget that im not in debian br
13:49|-|faderhval [~faderhval@0x5550acb4.adsl.cybercity.dk] has joined #debian
13:49<|dennis|>Greetings: before install begins, is there an option i can pass to the installer ,for it to not to use debian's default security.debian.org server for security updates, i want it to use my own internal one, we have over 100 machines, and going to the web to download every time is eating bandwidth......i tried editing the sources.list file under the /target/etc/apt fs but looks like it loads that info before..
13:50<faderhval>that takes care IRC thanks guys
13:50|-|sd2 [~beloved@241-177.static.alkar.net] has quit []
13:50<faderhval>of*
13:50|-|ifvoid changed nick to ifvoid|0389557
13:51<fxiny>qbit: hmmm : xmms2 clear clears nothing (read evidence) : sqlite3 medialib.db select value from media where key="title" ; shows many already deleted mp3
13:51|-|kmap [~kmap@barmen.interhost.no] has left #debian []
13:51|-|tuzhila [~tuzhila@83.143.152.216] has quit [Quit: õÈÏÖÕ Ñ ÏÔ ×ÁÓ]
13:51<qbit>fxiny, what the hell are you talking about?
13:52|-|kmap [~kmap@barmen.interhost.no] has joined #debian
13:52<fxiny>qbit: xmms2
13:52<qbit>haha
13:52[~]qbit has never been more confused in his life
13:52|-|faderhval [~faderhval@0x5550acb4.adsl.cybercity.dk] has quit []
13:52<fxiny>qbit: xmms2 cleear clears playlist only , but all titles are still in medialib.db
13:53|-|valdyn [~valdyn@ppp-88-217-22-91.dynamic.mnet-online.de] has joined #debian
13:53<qbit>you are talking about running xmms2 commands?
13:53<fxiny>qbit: yes
13:53<qbit>ahhhhhhh
13:54|-|EtherNet [~EtherNet@OL240-101.fibertel.com.ar] has quit [Ping timeout: 480 seconds]
13:54<fxiny>qbit: xmms2 radd dir adds files . ok ? if you clear : xmms2 clear it clears a split zero in medialib.db .
13:54|-|ibu [~ibu@e180241181.adsl.alicedsl.de] has joined #debian
13:55|-|faderhval [~faderhval@0x5550acb4.adsl.cybercity.dk] has joined #debian
13:56|-|faderhval [~faderhval@0x5550acb4.adsl.cybercity.dk] has quit []
13:56<qbit>cool
13:56|-|vertz [~vertz@216-119-201.231120.adsl.tele2.no] has joined #debian
13:56<fxiny>qbit: and : xmms2 coll is not avaiable on etch xmms2 version , i think is on Dr.Jekyill
13:57|-|vertz [~vertz@216-119-201.231120.adsl.tele2.no] has quit []
13:57|-|Guest81 [~sidux@Qe09b.q.pppool.de] has joined #debian
13:57<Guest81>hi there!
13:58<Guest81>how do i get the latest package of something from debian.org with a script using wget (without linking to a special version)?
13:58|-|EtherNet [~EtherNet@OL240-101.fibertel.com.ar] has joined #debian
13:58<Fattihvalos>so i've installed discover mdetect read-edid and window-x-sytem and icewm... and according to the guide i used i should be able to startx but i get an error msg saying Fatal server error no screens found?
13:58<fxiny>qbit: yuo can see : timesplayed and laststarted . i want this entries cause i want to use xmms2 in a more efficient way . but coll command is more advanced
13:59<tcsetattr>Guest81, got a problem with apt-get?
14:00<Fattihvalos>how do i configure x so i can start it
14:01<suiside>Fattihvalos: dpkg-reconfigure xorg-base
14:01<Guest81>tcsetattr: no, but i want to write a script that gets the latest madwifi-packages, downloads them to a cd. distri sidux don't come with madwifi because of legal issues. so i need madwifi to install manually without internet connection. i want to do that with a script.
14:01|-|kmap [~kmap@barmen.interhost.no] has left #debian []
14:01|-|zarchne [~michael@69.1.105.179] has quit [Quit: Leaving]
14:02<tcsetattr>when you say "latest" are you including unstable? experimental? testing?
14:02<suiside>Fattihvalos: sorry, dpkg-reconfigure xserver-xorg
14:02|-|djosr1939 [~don@adsl-75-52-95-191.dsl.ipltin.sbcglobal.net] has joined #debian
14:03<Guest81>tcsetattr: unstable, e.g. http://packages.debian.org/unstable/net/madwifi-source
14:04<Fattihvalos>hmm command not found
14:04<ranix>getting better at using linux is kind of a double-edged sword
14:04<ranix>on the one hand, you can do an install in 10 minutes that used to take all day
14:04<ranix>on the other hand, when you ask questions in #debian the room goes silent
14:04<ranix>:(
14:04<mjk>ranix: :-}
14:05|-|djosr1939 [~don@adsl-75-52-95-191.dsl.ipltin.sbcglobal.net] has quit []
14:05<suiside>Fattihvalos: as root
14:05[~]Fattihvalos blushes
14:05<tcsetattr>if you already found it on packages.debian.org then you can easily add it to your sources.list
14:06|-|djosr1939 [~don@adsl-75-52-95-191.dsl.ipltin.sbcglobal.net] has joined #debian
14:08|-|alp_ [~alp@gad13-2-82-231-179-70.fbx.proxad.net] has joined #debian
14:08|-|djosr1939 [~don@adsl-75-52-95-191.dsl.ipltin.sbcglobal.net] has quit []
14:08<ranix>so, nobody knows how to increase the number of days exim4 keeps logs for?
14:08<Guest81>tcsetattr: as i wrote, i want to download the packages, burn them on cd and then load them on a pc without internet access
14:09|-|sysop [~asturion@189.192.8.98] has quit [Read error: Connection reset by peer]
14:09<mjk>ranix: Maybe logrotate is responsible for that.
14:09<JasonS>ranix: tried #exim ?
14:10<tcsetattr>I don't know exim4 but I bet it uses either savelog or logrotate
14:10<fxiny>ranix: should be a logrotate issue . how long you want to keep 'em ?
14:10|-|sysop [~asturion@189.192.8.98] has joined #debian
14:10<mjk>ranix: I see /etc/logrotate.d/exim4-base
14:10<frank>ranix: take a look at: /etc/logrotate.d/exim-base
14:10|-|alp_ [~alp@gad13-2-82-231-179-70.fbx.proxad.net] has quit []
14:10<ranix>thanks guys
14:11|-|piranha [jabber-irc@number-41.thoughtcrime.us] has left #debian []
14:11<mjk>ranix: You're welcome. Now you know that you don't know enough yet, as this room isn't silent yet. ;-)
14:12<ranix>It was when I noticed that one of md's extended arguments didn't work :P
14:12<mjk>ranix: ;-)
14:12<ranix>but don't worry, I won't get cocky as long as I still have to ask you guys which manual to read
14:13<mjk>hehe
14:13<fxiny>manual ? exim4 manual is like the bible :P
14:13<ranix>more like the koran amirite
14:14|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has quit [Remote host closed the connection]
14:14<tcsetattr>I guess you just want to mirror the pool directory, Guest81
14:14|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has joined #debian
14:15<fxiny>but nothing compares to man muttrc :P
14:15<Guest81>tcsetattr: hmm, i want to tell wget to get the latest package from http://packages.debian.org/unstable/net/madwifi-source, which actually would be http://ftp.de.debian.org/debian/pool/main/m/module-assistant/module-assistant_0.10.11_all.deb
14:15<fxiny>over 4000 lines , heheheh
14:16<Fattihvalos>which mouseport should i use for a regular ps2 mouse?
14:16<tcsetattr>so if you just mirror the entire pool directory http://ftp.de.debian.org/debian/pool/main/m/module-assistant/ you'll always have the latest
14:17<suiside>Fattihvalos: What do you mean?
14:17<EmleyMoor>Fattihvalos: The regular ps2 mouse port, I guess
14:18<Fattihvalos>the xorg confi asks for mouse port /dev/input/mice,psaux,ttySO and so on
14:18|-|harald [~harald@pD95DD30E.dip.t-dialin.net] has joined #debian
14:18<EmleyMoor>psaux
14:19|-|eisen [~eisen@xdsl-87-78-79-170.netcologne.de] has quit [Read error: Connection reset by peer]
14:19|-|harald [~harald@pD95DD30E.dip.t-dialin.net] has quit []
14:19<EmleyMoor>(you need to prefix it appropriate
14:19<EmleyMoor>ly)
14:19|-|zarchne [~michael@69.1.105.179] has joined #debian
14:19|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
14:20<ranix>thanks guys, logrotate was what I was looking for
14:20<ranix>hot stuff
14:20<mjk>:-)
14:21|-|Rubbishbook [~rubbishbo@user-5af19105.tcl110.dsl.pol.co.uk] has quit [Remote host closed the connection]
14:22<ranix>Fattihvalos: you want to use /dev/input/mice for the most part. psaux works if you want to explicitly use the ps2 port, but then if you plug in a usb mouse it won't be recognized as a pointing device
14:22<ranix>(in X)
14:23|-|tycale [~tycale@242.67-244-81.adsl-dyn.isp.belgacom.be] has quit [Ping timeout: 480 seconds]
14:23|-|zarchne [~michael@69.1.105.179] has quit [Remote host closed the connection]
14:24<EmleyMoor>ranix: Does using /dev/input/mice allow plugging in of a USB mouse "on the fly" while a PS/2 mouse is also active?
14:24<ranix>EmleyMoor: probably
14:24<Fattihvalos>i tried dev/input/mice was a no go psaux is working but its not that important the box is only for server use :)
14:24|-|Guest81 [~sidux@Qe09b.q.pppool.de] has quit [Remote host closed the connection]
14:25|-|nomeata [nobody@nomeata.de] has joined #debian
14:25[~]EmleyMoor is almost ready to see if he's fixed his keyboard
14:26|-|azorg [~azorg@87.245.133.19] has quit [Quit: õÈÏÖÕ]
14:26<mjk>EmleyMoor: Why did it take so long? Had applications you didn't want to quit?
14:26<EmleyMoor>mjk: Yes
14:26<EmleyMoor>(a qemu running sid!)
14:26<mjk>EmleyMoor: Nice. It's good that CPU power is affordable by now.
14:27|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has quit [Quit: Back in a Bristow]
14:28|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has joined #debian
14:29|-|mode/#debian [+l 314] by debhelper
14:29<EmleyMoor>Damn, no go
14:29<tcsetattr>what's your keyboard problem?
14:30<EmleyMoor>My backtick and 3 keys do not give their shifted characters in X
14:30<mjk>EmleyMoor: Any saliences in /var/log/Xorg.0.log?
14:30<tcsetattr>oh, not anywhere close to the same keyboard problem as mine then
14:31<tcsetattr>xdmodmap -pke | grep grave
14:31<mjk>EmleyMoor: Oh, another possibility: You could have loaded a keymap through your ~/.xinitrc or something.
14:31<EmleyMoor>mjk: Nothing untoward
14:32<EmleyMoor>mjk: And no, I'm not loading one there
14:32<EmleyMoor>" and @ are in the right place
14:32<ranix>is tilde working properly
14:32|-|fxiny [~fxiny@82.52.16.60] has quit [Ping timeout: 480 seconds]
14:33<EmleyMoor>~ Yes
14:33<dpkg>really??? wohoo!
14:33<mjk>EmleyMoor: Okay, then it /could/ be a hardware problem (problem of keyboard controller).
14:33<ranix>unlikely
14:33<EmleyMoor>mjk: It works outside X
14:33<mjk>EmleyMoor: Oh, I forgot, okay.
14:33<tcsetattr>is tilde not the shifted backquote on your keyboard?
14:34|-|magnetic [~magnetic@14.Red-88-26-177.staticIP.rima-tde.net] has quit [Ping timeout: 480 seconds]
14:35<ranix>I went through something similar to this last week with volume buttons on a laptop
14:35<mjk>EmleyMoor: You could move your xorg.conf and create a new one (dpkg-reconfigure xserver-xorg?) to see if it's an xorg.conf problem.
14:35|-|slaxz [~slaxz@p54B47957.dip.t-dialin.net] has quit [Remote host closed the connection]
14:36|-|Cave_ [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has quit [Remote host closed the connection]
14:36|-|tralala_ [~joro@athedsl-250168.home.otenet.gr] has quit [Ping timeout: 480 seconds]
14:36|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
14:36<ranix>turned out that there was a call to xmodmap in .xinitrc
14:37<ranix>damned if I know what put it there
14:37<mjk>ranix: Probably shrooms.
14:37|-|udo [~udo@212.pool80-103-123.dynamic.orange.es] has quit [Ping timeout: 480 seconds]
14:37<mjk>ranix: ;-)
14:37<mjk>Or alternatively weed.
14:37<ranix>could have been the near-lethal dose of mountain dew
14:38|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has quit [Quit: Lost terminal]
14:39|-|mode/#debian [+l 308] by debhelper
14:39<ranix>what gives with x.org replacing .Xdefaults with .Xresources
14:39|-|faderhval [~faderhval@0x5550acb4.adsl.cybercity.dk] has joined #debian
14:39<ranix>were they on crack, or am I confused
14:39|-|Fattihvalos [~fader@0x5550acb4.adsl.cybercity.dk] has quit []
14:39<mjk>ranix: I dunno ... I know these two files since at least 1993.
14:39<ranix>.Xdefaults seems to not work anymore
14:40<mjk>ranix: In testing, it works perfectly.
14:40<ranix>it might be getting ignored somehow because of my session manager?
14:41<mjk>ranix: Hm, wait ... or is one of the two files to be read by the applications in real-time, while the other has be read by "xrdb -merge" or something?
14:42<tcsetattr>.Xresources is the traditional name for a file that you load with xrdb, thus making those resources available to all X clients that connect to the server; .Xdefaults is loaded by clients directly, so only works for clients on the same host
14:43|-|wolog [~wolog@lns-bzn-40-82-251-185-243.adsl.proxad.net] has quit [Ping timeout: 480 seconds]
14:44<mjk>tcsetattr: Thanks for the explanation! So my memory didn't fail completely ... yet.
14:45<tcsetattr>well, at least my memory agrees with yours. a while ago I tried to find the history of .Xresources and couldn't come up with anything. I just know I've had it for a long time, like you
14:46|-|lambda [~lambda@88-138-52-236.adslgp.cegetel.net] has quit [Ping timeout: 480 seconds]
14:47<faderhval>as i recall debian or aptitude has an all in one php/apache/mysql server anyone remember what the package name is?
14:48<ranix>.Xresources appears to get loaded automagically by X on startup
14:48<ranix>while .Xdefaults needs to be manually loaded by xrdb
14:48|-|Metalqga [~metalqga@cable-84-43-141-59.mnet.bg] has left #debian []
14:48<ranix>which is opposite what my memory provides
14:49<mjk>ranix: automagically? I'd say there's something like "test -f ~/.Xresources && xrdb ~/.Xresources" in some /etc/X11/xinitrc or whatever.
14:49<ranix>there isn't that I could find, and I hunted
14:49|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
14:50<mjk>ranix: .Xdefaults don't need xrdb. I've reconfigured my patched xosview by editing that file, and restarting xosview was all I had to do to make it use the changed values.
14:50<mjk>"doesn't", even.
14:50<tcsetattr>that might be what actually changed recently. the loading of .Xresources was added to the default xinitrc, or something.
14:51|-|evandro7 [~evandro7@201-27-166-72.dsl.telesp.net.br] has joined #debian
14:51<ranix>yeah, on this system running Etch, .Xdefaults is not loaded on startup and .Xresources is
14:51|-|evandro7 [~evandro7@201-27-166-72.dsl.telesp.net.br] has quit []
14:51|-|faderhval [~faderhval@0x5550acb4.adsl.cybercity.dk] has quit [Quit: Lost terminal]
14:51<ranix>this is maybe a week old install
14:52<tcsetattr>hmm.. strace reveals that things are looking for .Xdefaults-`hostname`
14:52<tcsetattr>and *not* looking for .Xdefaults
14:52<ranix>that's... weird
14:53|-|sysop [~asturion@189.192.8.98] has quit [Read error: Connection reset by peer]
14:54|-|sysop [~asturion@189.192.8.98] has joined #debian
14:55|-|RaSeBo [~tzintirim@86.106.5.251] has joined #debian
14:55|-|libereco [~libereco@189.175.119.34] has joined #debian
14:56<tcsetattr>aha, X(7) reveals that XENVIRONMENT=$HOME/.Xdefaults should take care of it
14:56<tcsetattr>yep, that makes it look there. doesn't matter to me, I always used .Xresources alone anyway :)
14:57|-|lambda [~lambda@84.4.108.247] has joined #debian
14:57<ranix>I'll just switch to doing .Xresources for that anyway, but man that was nifty
14:57<ranix>confused the piss out of me for like two hours on Friday
14:57|-|Althaser [~GNU@bl7-223-96.dsl.telepac.pt] has joined #debian
14:57<tcsetattr>_and_ it has the suggestion of using .Xresources too
14:58<ranix>I'd been using .Xdefaults since Potato so when it didn't work I thought I was having a nightmare or something
14:59<tcsetattr>my fuzzy memory is that it used to look for both .Xdefaults and .Xdefaults-hostname. I don't know why it only does one now
15:01|-|StCyr [~cyb@cable-62-205-68-2.upc.chello.be] has joined #debian
15:02<tcsetattr>checking some old man pages contradicts that fuzzy memory though.
15:02|-|mjk [~mjk@p54AC68E9.dip.t-dialin.net] has quit [Quit: leaving]
15:02|-|sysop [~asturion@189.192.8.98] has quit [Ping timeout: 480 seconds]
15:02|-|pcharly [~charly@3.Red-80-25-110.staticIP.rima-tde.net] has joined #debian
15:04|-|tycale [~tycale@242.67-244-81.adsl-dyn.isp.belgacom.be] has joined #debian
15:05|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
15:06<ranix>X3: Reunion is getting released for Linux on August 1
15:06<ranix>If any of you guys enjoy having fun and have a modern machine, check it out
15:07<ranix>It's going to give me an excuse to bust out the old joystick
15:07|-|d0rt [~ni@d210h5.public.simons-rock.edu] has quit [Quit: Konversation terminated!]
15:08|-|LightKnight [~gabry@adsl-ull-173-180.41-151.net24.it] has joined #debian
15:08<tcsetattr>some kind of shoot-em-up game I presume
15:10|-|kurumin [~kurumin@189-10-78-67.pvoce702.dsl.brasiltelecom.net.br] has joined #debian
15:10|-|kurumin [~kurumin@189-10-78-67.pvoce702.dsl.brasiltelecom.net.br] has left #debian []
15:12|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has quit [Quit: smeding go bye bye.]
15:16|-|Bolonjovi [kubus_mara@222.124.158.182] has joined #debian
15:17<Bolonjovi>hey anyone, i need help on gnome is this the place
15:17<Bolonjovi>??
15:18<ranix>space sim, tcsetattr
15:18<ranix>instead of asking if you can ask a question, just ask the question Bolonjovi. You'll find that the guys here aren't trolls and will actually answer you if they can, or point you to the right place if they can't
15:18<ranix>it has to be a pretty wild question to not get some kind of useful response
15:19<ranix>(we do expect you to have googled it first)
15:20<Bolonjovi>well ok, gnome refused to shutdown/logoff if one of my ethernet is UP
15:20|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
15:20<Bolonjovi>so i have put it DOWN first before shutting down
15:20<Bolonjovi>i dont know, maybe there something got todo with avahi something
15:21|-|lsb [~lsb@22.172.110-65.q9.net] has quit [Remote host closed the connection]
15:21|-|lsb [~lsb@22.172.110-65.q9.net] has joined #debian
15:21|-|lsb [~lsb@22.172.110-65.q9.net] has quit [Remote host closed the connection]
15:22|-|lsb [~lsb@22.172.110-65.q9.net] has joined #debian
15:23|-|Fattihvalos [~fader@0x5550acb4.adsl.cybercity.dk] has joined #debian
15:23|-|FL0RlN [whois@79.112.0.94] has joined #debian
15:23|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has joined #debian
15:23<Trashynovel>why, good sirs, wouldn't the lovely debian install not be able to connect to a Belkin router?
15:24<ranix>perhaps because you don't know enough about your router to know anything more than its manufacturer, old chap
15:25<Trashynovel>probably
15:25<Trashynovel>it looks like its about to fall apart
15:25|-|rbrito [~rbrito@201.76.27.2] has joined #debian
15:25<Trashynovel>but we put in the ip address
15:25<ranix>does it do DHCP?
15:25<Trashynovel>and the subnet mask
15:25<Trashynovel>no
15:25<rbrito>Hi there.
15:25<Trashynovel>in fact
15:25<ranix>so you edited /etc/network/interfaces properly for a static ip?
15:25<Trashynovel>we've never been able to connect wireless to anything
15:25<ranix>man interfaces has some help on that topic
15:26<Trashynovel>um
15:26<ranix>oh, this is wireless?
15:26<Trashynovel>we are web installing
15:26<rbrito>Is there anybody that knows how to make firefox to open a text/pgp page in firefox?
15:26|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has quit []
15:26<rbrito>I like to browse incoming.debian.org and see the *.changes files there.
15:26|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has joined #debian
15:26<ranix>the web install doesn't need the internet to complete
15:26<ranix>it's kind of a misnomer
15:27<rbrito>Unfortunately, they are now of type text/pgp and Firefox wants to open them with less.
15:27<Trashynovel>well, we still need the internet
15:27<Ganneff>there is aplugin
15:27|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has quit []
15:27<ranix>select no packages when you get to the deselect portion of the install. You know, where it asks you if you want to install "Desktop" "Laptop" "Web Server", etc.
15:27<Ganneff>that lets you open all stuff within ff
15:27<Fattihvalos>hey guys anybody know where i can find a guide to configure my network with ifcinfig
15:27<Fattihvalos>ifconfig
15:27|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has joined #debian
15:27<ranix>then when installation is complete, use /etc/network/interfaces to configure the network and select packages manually with deselect or apt
15:28<Ganneff>called openinbrowser
15:28|-|LightKnight [~gabry@adsl-ull-173-180.41-151.net24.it] has quit [Remote host closed the connection]
15:28<Trashynovel>thanks ranix
15:28<rbrito>Ganneff, Thanks. I didn't know it...
15:28<ranix>no prob Trashynovel
15:28<Trashynovel>we'll try that when we next get there
15:28<rbrito>I will try it right now and report back.
15:28<rbrito>Just one moment.
15:28<ranix>you'll find that to be the best way to install Debian whether you have access to the internet on install or not
15:29|-|magnetic [~magnetic@31.Red-83-35-185.dynamicIP.rima-tde.net] has joined #debian
15:29<rbrito>Ganneff, is it available only in unstable?
15:29<rbrito>I'm using testing here and I don't seem to have this...
15:29<Ganneff>its available from whatever.mozilla.something
15:29<ranix>hey it's time to go home
15:30<Trashynovel>cya ranix
15:30<ranix>ciao
15:30<Trashynovel>just when I was about to ask another question :p
15:30<Ganneff>normal addon stuff
15:30<rbrito>Ganneff, oh, it's not a Debian package...
15:30<Ganneff>no
15:30|-|LightKnight [~gabry@adsl-ull-173-180.41-151.net24.it] has joined #debian
15:30<rbrito>Ganneff, I see...
15:30[~]Ganneff never thought that packaging such addons makes any sense
15:30<rbrito>Perhaps I can packge it into Debian...
15:31|-|Frolic [~ederm@frolic.user.oftc.net] has quit [Quit: Saindo]
15:31<rbrito>Ganneff, are you sure this is the name?
15:31<rbrito>It isn't in the first page of google hits...
15:32|-|udo [~udo@114.pool80-103-121.dynamic.orange.es] has joined #debian
15:32<Ganneff>rbrito: http://kosh.ganneff.de/~joerg/moo.html
15:33|-|schoappied [~dirk@cc955125-a.groni1.gr.home.nl] has quit [Remote host closed the connection]
15:33|-|neorom [~neorom@rob92-3-82-224-198-94.fbx.proxad.net] has joined #debian
15:33<Ganneff>rbrito: and searching mozilla addons with google is plain useless
15:33<Ganneff>there is a mozilla addons site for that
15:33<rbrito>Ganneff, I rarely use any extension to firefox...
15:33<Ganneff>well. i have 38 in this ff
15:34<rbrito>I don't even know which would be the useful ones...
15:34|-|esaym [~user@cpe-72-183-198-134.satx.res.rr.com] has joined #debian
15:35<rbrito>Nice collection of addons, BTW...
15:36|-|meandtheshell [~markus@85.127.104.34] has quit [Quit: Leaving.]
15:36|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
15:36|-|StCyr [~cyb@cable-62-205-68-2.upc.chello.be] has quit [Quit: Leaving.]
15:37|-|schoinobates [~lmamane@capsaicin.mamane.lu] has quit [Quit: Leaving]
15:37|-|myles [~myles@CPE0050181121d5-CM0012254493da.cpe.net.cable.rogers.com] has quit [Quit: Goodbye]
15:37|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has joined #debian
15:38|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has quit [Remote host closed the connection]
15:38<blarson>What I'd like for iceweasel is a subtracton to get rid of the line with "getting started" and "headlines".
15:38|-|dexterhcito [~knoppix@224.Red-83-40-189.dynamicIP.rima-tde.net] has joined #debian
15:39|-|hazard2 [~hazard@71.174.54.250] has joined #debian
15:39<blarson>I'd call it a useless line, but that makes it seem better than it is. The only times those links get hit is accedentaly, and it wastes valuable screen real estate.
15:40|-|dexterhcito [~knoppix@224.Red-83-40-189.dynamicIP.rima-tde.net] has quit []
15:41|-|h3llfire [~h3llfire@86.106.5.251] has joined #debian
15:41|-|nomeata [nobody@nomeata.de] has quit [Ping timeout: 480 seconds]
15:42<stew>blarson: i'm not sure what you mean? perhaps one of the toolbars that can be disabled via view->toolbars?
15:42<stew>blarson: or else perhaps you can isntall a different theme?
15:43|-|h3llfire [~h3llfire@86.106.5.251] has quit []
15:43|-|lloeki [~Lloeki@4va54-4-82-244-102-52.fbx.proxad.net] has joined #debian
15:43|-|TumaT [~suporte@201.29.39.34] has left #debian [Saindo]
15:43|-|lloeki [~Lloeki@4va54-4-82-244-102-52.fbx.proxad.net] has quit []
15:44|-|h3llfire [~h3llfire@86.106.5.251] has joined #debian
15:45<blarson>stew: Thanks, it was the "booksmark toolbar". I searched the prefernces for some way to turn of the *&(&^$@ thing many times.
15:45|-|h3llfire [~h3llfire@86.106.5.251] has quit []
15:45|-|RaSeBo [~tzintirim@86.106.5.251] has quit [Remote host closed the connection]
15:46|-|rbrito [~rbrito@201.76.27.2] has quit [Quit: Leaving]
15:46|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has joined #debian
15:46|-|sindre [~sindre@3.84-49-134.nextgentel.com] has joined #debian
15:46<blarson>Mozilla seems to be following microsoft's lead in moving things around randomly to irritate users who got used to the old way.
15:47|-|emonge [~emonge@168.243.176.133] has joined #debian
15:47|-|janrocks [~janrocks@82-33-137-88.cable.ubr02.wiga.blueyonder.co.uk] has joined #debian
15:49<dondelelcaro>blarson: heh
15:51|-|pcharly [~charly@3.Red-80-25-110.staticIP.rima-tde.net] has quit [Quit: Saliendo]
15:52|-|megapixel [~Miranda@p54B3668E.dip.t-dialin.net] has joined #debian
15:52|-|FL0RlN [whois@79.112.0.94] has quit []
15:53|-|neorom [~neorom@rob92-3-82-224-198-94.fbx.proxad.net] has left #debian []
15:53|-|Mo [~mo@e178246131.adsl.alicedsl.de] has quit [Quit: Verlassend]
15:54|-|Knag2 [eduard@218.Red-88-9-83.dynamicIP.rima-tde.net] has joined #debian
15:54<megapixel>is it true, that the patch to load DSDT from initrd is not integrated in debian etch kernel?
15:54|-|Knag2 [eduard@218.Red-88-9-83.dynamicIP.rima-tde.net] has quit []
15:55<Fattihvalos>sigh... im out of ideas i need to configure my network manualy with ifconfig and the results of #ifconfig looke like they should but i have no connection to the internet?? any ideas?
15:57|-|nomeata [nobody@nomeata.de] has joined #debian
15:57<blarson>Fattihvalos: Could be a routing problem. Can you get to the local router?
15:57|-|Rajohan`Linux [~Rajohan@ti231210a080-7181.bb.online.no] has quit [Ping timeout: 480 seconds]
15:57|-|debUsr42 [~sanctus@p54BA5659.dip.t-dialin.net] has joined #debian
15:58<Fattihvalos>yup
15:58|-|Rajohan`Linux [~Rajohan@ti231210a080-1004.bb.online.no] has joined #debian
15:58<tcsetattr>so traceroute -n somewhere and see how far you get
15:58|-|Ronin- [~jason@CPE00609784918f-CM00080d77ee84.cpe.net.cable.rogers.com] has joined #debian
15:58|-|LuG42 [~nexus@p50855D5B.dip.t-dialin.net] has joined #debian
15:58<blarson>Fattihvalos: Then check "netstat -rn".
15:59|-|LuG42 [~nexus@p50855D5B.dip.t-dialin.net] has left #debian []
16:00<Fattihvalos>meh traceroute : command not found
16:00<streuner>!installit
16:00<dpkg>*** NEWS FLASH! *** Your box does not come with every app, tool and utility known to debiankind installed already. If you find that the program you've been told to use isn't there, install it. Also ask me about <search>. if someone suggests an application to you, it's highly likely that it's available via apt-get
16:00|-|Ronin- [~jason@CPE00609784918f-CM00080d77ee84.cpe.net.cable.rogers.com] has quit []
16:00<tarzeau>fortune cookie!
16:00|-|JasonS [~jason@CPE00609784918f-CM00080d77ee84.cpe.net.cable.rogers.com] has quit [Ping timeout: 480 seconds]
16:00|-|GhostlyDeath [~ghostlyde@ool-44c5a585.dyn.optonline.net] has joined #debian
16:01|-|MoDaX [~nth@lan-84-240-22-131.vln.skynet.lt] has quit [Read error: Connection reset by peer]
16:01<tcsetattr>traceroute is Priority: important and its description ends with: "Install traceroute if you need a tool for diagnosing network connectivity problems."
16:01|-|EnglishGent [~martin@ai-core.demon.co.uk] has joined #debian
16:02|-|zarchne [~michael@69.1.105.179] has joined #debian
16:02|-|EnglishGent [~martin@ai-core.demon.co.uk] has quit []
16:02|-|MoDaX [~nth@lan-84-240-22-131.vln.skynet.lt] has joined #debian
16:02<Fattihvalos>well a bit hard installing with apt-get when i dont have a internet connection :)
16:02|-|santos [~santos@200.223.159.218] has joined #debian
16:03|-|santos [~santos@200.223.159.218] has quit []
16:03|-|mattrope [~mattrope@adsl-75-8-234-148.dsl.scrm01.sbcglobal.net] has joined #debian
16:03|-|mattrope [~mattrope@adsl-75-8-234-148.dsl.scrm01.sbcglobal.net] has quit []
16:04|-|tycale [~tycale@242.67-244-81.adsl-dyn.isp.belgacom.be] has quit [Ping timeout: 480 seconds]
16:04<tcsetattr>doesn't "Priority: important" mean it should be in the default installation? no sense having ifconfig without traceroute unless you're exceptionally over-confident :)
16:04|-|BrianR [brianr@static-72-70-36-11.bstnma.fios.verizon.net] has joined #debian
16:04|-|BrianR [brianr@static-72-70-36-11.bstnma.fios.verizon.net] has left #debian []
16:04<tcsetattr>netstat -rn is another nice thing of course
16:05<dondelelcaro>it means it should be in almost everyone's installation, but there's no real such thing as a default install
16:05|-|BrianR [brianr@static-72-70-36-11.bstnma.fios.verizon.net] has joined #debian
16:05<Fattihvalos>well netstat output was: Destination: 10.0.0.0 gateway :0.0.0.0 genmask 255.255.255.255 flags :U MSS window 0 0 irtt ifAace 0 eth0
16:05[~]dondelelcaro personally is a fan of mtr
16:05<BrianR>does anyone know of a program like morseall which will let me use a single key or two key keyboard to enter text using morse code?
16:06<Fattihvalos>i had a problem under the install with package choosing and i ended up skipping it so i have basicly nothing :)
16:06<SixF9>W: Unable to locate package morseall
16:06|-|johnh [~johnh@rrcs-71-41-80-18.se.biz.rr.com] has quit [Quit: Leaving]
16:07|-|morpheus [~morpheus@DSL01.83.171.152.218.ip-pool.NEFkom.net] has joined #debian
16:07<BrianR>SixF9: Try a quick google search - it plugs into the atk framework to stuff keystrokes into X, but it's somewhat bitrotten :(
16:08<SixF9>you tell _me_ to do a google search? i see
16:08<BrianR>Ok... http://morseall.org/
16:08<SixF9>its not packaged for debian. so i can hardly tell you a related package
16:08<tcsetattr>do you not have a default route (Destination 0.0.0.0) with gateway matching the gateway in your /etc/network/interfaces?
16:09|-|H [~h@tor-irc.dnsbl.oftc.net] has joined #debian
16:09<BrianR>I'd like to package one if I can find one that's not bitrotten...
16:09|-|q07sa [~q07sa@81.203.240.3.dyn.user.ono.com] has joined #debian
16:09<SixF9>whatever bitrotten means
16:09|-|ewanm89_laptop [~ewanm89@host86-151-100-255.range86-151.btcentralplus.com] has quit [Quit: ZzZzZzZzZzZzZzZz]
16:09<BrianR>unmmaintained upstream...
16:10|-|epiR [~epiR@57.pool80-102-34.dynamic.orange.es] has joined #debian
16:10|-|epiR [~epiR@57.pool80-102-34.dynamic.orange.es] has left #debian []
16:10|-|egon_spengler [~egon@pool-71-98-87-192.ipslin.dsl-w.verizon.net] has quit [Quit: Konversation terminated!]
16:10<SixF9>maybe typing in morse code is not trendy anymore?
16:10<BrianR>hmm.. I'm on the wrong channel.
16:10|-|BrianR [brianr@static-72-70-36-11.bstnma.fios.verizon.net] has left #debian []
16:10<stew>SixF9: it never was, but it is an accessibility issue for some
16:11<tcsetattr>the ultimate hunt-and-peck typist?
16:11|-|takt [~takt@p508C5173.dip.t-dialin.net] has joined #debian
16:11|-|atperez [~atperez@200.77.144.21] has joined #debian
16:11<Fattihvalos>tcsetattr there are no gateway specified in that file
16:11<takt>greetings
16:12<takt>does anybody know, how I can put starters from my xfce menu into my toolbar?
16:12<Trashynovel>say, for example, that we were trying to net install debian by connecting to an unsecured network; is there any way to force the install to connect with no DCHP?
16:12<dondelelcaro>Trashynovel: with the expert mode, yes.
16:12<Trashynovel>ah
16:13<dondelelcaro>though using a known hostile network to install is a bad idea
16:13<tcsetattr>Fattihvalos, without a gateway you expect to get onto the Internet?
16:13<Trashynovel>well, we are not experts
16:13<Trashynovel>its our unsecured network
16:13<Trashynovel>its just unsecured for some odd reason
16:14|-|H [~h@tor-irc.dnsbl.oftc.net] has quit [Remote host closed the connection]
16:14|-|H [~h@tor-irc.dnsbl.oftc.net] has joined #debian
16:14<Fattihvalos>tcsetattr nope not at all but im very new to linux and im trying my best to setup the darn thing with #route and #ifconfig but its not helping much :)
16:15|-|ifvoid|0389557 changed nick to ifvoid
16:15|-|Bolonjovi [kubus_mara@222.124.158.182] has quit []
16:15<tcsetattr>doing it manually, you need to "route add default gw A.B.C.D" where A.B.C.D is your gateway's IP address.
16:17<Fattihvalos>thank you problem solved :)
16:17|-|bl4de [~Steffen@p549CBE6C.dip0.t-ipconnect.de] has quit [Quit: /* no comment */]
16:17|-|debUsr42 [~sanctus@p54BA5659.dip.t-dialin.net] has quit [Remote host closed the connection]
16:20|-|Lin [~igor@200.179.57.52] has joined #debian
16:20|-|wenchien [~wenchien@59-105-176-11.adsl.static.seed.net.tw] has quit [Ping timeout: 480 seconds]
16:20<Lin>hi all
16:21<Lin>there is something better than apt-proxy? I dont fell confortable with this message: exceptions.RuntimeError: TODO: multiple clients not implemented yet
16:21<tarzeau>hehe
16:22<tcsetattr>hmm... I never saw that happen with apt-proxy, and I'm pretty sure I've had multiple clients use it simultaneously
16:22<Lin>tcsetattr: i have something like 200 clients acessing it. It froze sometimes.. its very annoying.
16:22<tcsetattr>apt-cacher is another apt-proxy'ish thing. Maybe it's better
16:22|-|Glenn^BF [~fburlet@user-85-201-8-232.tvcablenet.be] has quit [Remote host closed the connection]
16:23|-|zzang [zzang@p549CFF8E.dip.t-dialin.net] has joined #debian
16:24|-|lambda [~lambda@84.4.108.247] has quit [Remote host closed the connection]
16:27|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has joined #debian
16:27|-|PinBalWyz [~doa@64.184.139.235] has quit [Ping timeout: 480 seconds]
16:30|-|themill [~stuart@86.53.48.59] has joined #debian
16:34|-|cydork [~vihang@85-18-66-25.ip.fastwebnet.it] has joined #debian
16:35|-|remy [~remy@ABordeaux-156-1-149-196.w90-5.abo.wanadoo.fr] has quit [Quit: .]
16:36|-|lupine [lupine@nick.lupine.me.uk] has joined #debian
16:36|-|lupine_ [lupine@nick.lupine.me.uk] has quit [Ping timeout: 480 seconds]
16:36|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
16:37<Trashynovel>so, we have grub feeding us an error 21 for a USB drive
16:37<Trashynovel>any suggestions?
16:38|-|zzang_ [zzang@p549CFF8E.dip.t-dialin.net] has joined #debian
16:38|-|zzang_ [zzang@p549CFF8E.dip.t-dialin.net] has quit []
16:40|-|elhaz_ [~elhaz@adsl190-28-72-112.epm.net.co] has joined #debian
16:40<elhaz_>Hi.
16:41<elhaz_>fro 3 days ago i don't see any update in Debian sid..
16:41<elhaz_>*fro
16:41<elhaz_>*for
16:42<tcsetattr>on what mirror?
16:42<Trashynovel>grub doesn't like my USB drive
16:42<Trashynovel>I swear
16:42<Trashynovel>it actually hates it
16:42<elhaz_>tcsetattr, ftp.debian.org
16:42<Trashynovel>it ignores it out of spite
16:42<elhaz_>hummm
16:42<elhaz_>:s
16:43<Trashynovel>can anyone help me?
16:44|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has joined #debian
16:45<tcsetattr>yeah, looks like ftp.debian.org is taking suckage to a new level
16:45|-|Overfiend [~branden@cpe-65-29-71-69.indy.res.rr.com] has quit [Ping timeout: 480 seconds]
16:45<tcsetattr>I don't know anything about grub, but your question might attract more attention if you were less vague. What is it, a floppy drive on USB?
16:46<Trashynovel>USB hard drive
16:46|-|takt [~takt@p508C5173.dip.t-dialin.net] has quit [Quit: Verlassend]
16:46<Trashynovel>Linux is installed on it fine
16:46<tcsetattr>see how far off my guess was :)
16:46<elhaz_>humm i see...
16:46<Trashynovel>but Grub gives us error 21 when we try and try and boot up the laptop
16:47<lupine>Don't suppose any has managed to get eciadsl working under lenny amd64 and can help me out with troubleshooting, can they?
16:47<lupine>anyone&
16:47<lupine>s/&/*/ :D
16:48<Trashynovel>I've had a look though bios and I can't find anything that says its sensing th USB drive at all, but the USB drive is still in the Boot Order
16:48|-|nomeata [nobody@nomeata.de] has quit [Quit: Client exiting]
16:48<Trashynovel>and it tries to boot the USB drive fine, and coemes up with German text
16:49<elhaz_>i will try with another mirror.....
16:49<Trashynovel>but the important thing is, to get grub working, or get it out the way to windows can load fine
16:49<Trashynovel>any clearer, tcsetattr?
16:49|-|ryu [~chris@p5487D826.dip.t-dialin.net] has joined #debian
16:49|-|ryu [~chris@p5487D826.dip.t-dialin.net] has left #debian [Gone for Good]
16:50|-|E0x [~moya@133.87.3.196.l.sta.codetel.net.do] has quit [Quit: off]
16:50|-|morpheus_ [~morpheus@DSL01.83.171.162.4.ip-pool.NEFkom.net] has joined #debian
16:50|-|peter__ [peter@host-n1-118-194.telpol.net.pl] has quit [Quit: Leaving]
16:51|-|megapixel [~Miranda@p54B3668E.dip.t-dialin.net] has quit [Quit: Miranda IM! Smaller, Faster, Easier. http://miranda-im.org]
16:52|-|wckdkl0wn [~kevin@h15.173.28.71.ip.alltel.net] has joined #debian
16:52|-|Lin [~igor@200.179.57.52] has quit [Quit: Ex-Chat]
16:52<wckdkl0wn>ok i just install feisty ubuntu and did the update.. whatelse should i do on a fresh isntall?
16:52|-|abba [~abba@static-71-251-20-196.nycmny.fios.verizon.net] has joined #debian
16:53<elhaz_>go to > #ubuntu :)
16:53|-|abba [~abba@static-71-251-20-196.nycmny.fios.verizon.net] has quit [Remote host closed the connection]
16:53<wckdkl0wn>elhaz_, lmao sry i thought it auto put me in it.. my bad
16:56|-|morpheus__ [~morpheus@DSL01.83.171.168.204.ip-pool.NEFkom.net] has joined #debian
16:57|-|morpheus [~morpheus@DSL01.83.171.152.218.ip-pool.NEFkom.net] has quit [Ping timeout: 480 seconds]
16:58|-|Overfiend [~branden@cpe-65-29-71-69.indy.res.rr.com] has joined #debian
16:59|-|klys_ [~admini@72.8.101.65] has joined #debian
17:00|-|wckdkl0wn [~kevin@h15.173.28.71.ip.alltel.net] has left #debian [Leaving]
17:01|-|q07sa [~q07sa@81.203.240.3.dyn.user.ono.com] has quit [Remote host closed the connection]
17:01|-|Quertyf [~Quertyf@jellek.xs4all.nl] has joined #debian
17:01|-|Quertyf [~Quertyf@jellek.xs4all.nl] has quit []
17:02|-|klys [~admini@72.8.101.65] has quit [Ping timeout: 480 seconds]
17:03|-|sam__ [~sam@c-71-233-86-64.hsd1.nh.comcast.net] has joined #debian
17:03|-|lupine_ [lupine@nick.lupine.me.uk] has joined #debian
17:03|-|sam__ [~sam@c-71-233-86-64.hsd1.nh.comcast.net] has quit [Read error: Connection reset by peer]
17:03|-|abrotman [~abrotman@c-71-230-49-187.hsd1.pa.comcast.net] has joined #debian
17:03|-|lupine [lupine@nick.lupine.me.uk] has quit [Read error: Network is unreachable]
17:03|-|morpheus_ [~morpheus@DSL01.83.171.162.4.ip-pool.NEFkom.net] has quit [Ping timeout: 480 seconds]
17:05|-|zzang [zzang@p549CFF8E.dip.t-dialin.net] has quit [Remote host closed the connection]
17:05|-|Skyrail [~Skyrail@212.32.96.173] has quit [Read error: Connection reset by peer]
17:06|-|lambda [~lambda@88-136-64-10.adslgp.cegetel.net] has joined #debian
17:07|-|myles [~myles@bas10-toronto12-1096758579.dsl.bell.ca] has joined #debian
17:09|-|elhaz_ [~elhaz@adsl190-28-72-112.epm.net.co] has quit [Quit: Leaving]
17:11|-|NightMonkey [~NightMonk@nightmonkey.user.oftc.net] has joined #debian
17:12|-|madroach [madroach.d@p5B11B76C.dip0.t-ipconnect.de] has joined #debian
17:14|-|stoffepojken [~stoffe@c213-200-184-137.bredband.comhem.se] has quit [Quit: Lämnar]
17:15|-|fixxxer [~aavelar@189.135.136.77] has quit [Remote host closed the connection]
17:15|-|fixxxer [~aavelar@189.135.136.77] has joined #debian
17:17|-|ruslan [ruslan@ppp91-122-46-235.pppoe.avangard-dsl.ru] has joined #debian
17:17<ruslan>Narod!!pomogite pliz!! Kak na debian drava na videokarty postavit"?????
17:18<chealer>!ru
17:18<dpkg>ru is probably Russian speakers, please use (Pogalujsta, zajdite na) (Pazhaluista, zahodite na) #debian-russian @ irc.freenode.net
17:18<ruslan>ok )
17:20|-|fixxxer [~aavelar@189.135.136.77] has quit [Remote host closed the connection]
17:20|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
17:21|-|madroach [madroach.d@p5B11B76C.dip0.t-ipconnect.de] has quit [Remote host closed the connection]
17:23|-|ruslan [ruslan@ppp91-122-46-235.pppoe.avangard-dsl.ru] has quit [Quit: using sirc version 2.211+KSIRC/1.3.12]
17:24|-|debiantion [~user@IGLD-84-229-82-231.inter.net.il] has quit [Quit: Leaving]
17:25|-|E0x [~moya@tdev252-5.codetel.net.do] has joined #debian
17:28|-|kurumin [~kurumin@189-015-203-120.xd-dynamic.ctbcnetsuper.com.br] has joined #debian
17:28|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has joined #debian
17:29<EmleyMoor>I have reconfigured xserver-xorg but my keyboard still isn't right, with two keys (` and 3) not producing their shifted characters in X
17:30|-|kurumin [~kurumin@189-015-203-120.xd-dynamic.ctbcnetsuper.com.br] has quit [Remote host closed the connection]
17:31<EmleyMoor>This is a pain in the neck^Wposterior when writing about money
17:31<tcsetattr>like I said a few hours back, could you run xmodmap -pke|grep grave
17:31|-|cydork [~vihang@85-18-66-25.ip.fastwebnet.it] has quit [Quit: Leaving]
17:32<EmleyMoor>keycode 49 = grave
17:32<tcsetattr>ok, so it's missing the second part.
17:33<EmleyMoor>... and no doubt the bit for AltGr too... and 3 is lacking its shifted and 4 its AltGr'd as well
17:33|-|fixxxer [~aavelar@189.135.136.77] has joined #debian
17:33<EmleyMoor>So, how do I fix?
17:33<tcsetattr>xmodmap -e 'keysym grave = grave asciitilde'
17:34<tcsetattr>as for how it got that way, I can't guess
17:34<EmleyMoor>Surely its not asciitilde
17:34<tcsetattr>why not?
17:34<EmleyMoor>Isn't that ~?
17:34|-|MoDaX [~nth@lan-84-240-22-131.vln.skynet.lt] has quit [Read error: Connection reset by peer]
17:35<EmleyMoor>Yes, it is - not the right character
17:35<tcsetattr>yeah, the ~ is on top of the ` on every keyboard I've ever seen (at least every keyboard that has a ` key)
17:35<EmleyMoor>No, ~ is on top of #
17:35<tcsetattr>you must be one of them foreigners :)
17:35|-|MoDaX [~nth@lan-84-240-22-131.vln.skynet.lt] has joined #debian
17:35|-|doobian [~Grey@host86-141-103-131.range86-141.btcentralplus.com] has joined #debian
17:35<tcsetattr>your keyboard is un-American :)
17:36<streuner>o_O
17:36<EmleyMoor>It's better than an un-English one :)
17:36<doobian>whoops
17:36<streuner>Dont do that doobian
17:36<doobian>I know.
17:36|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
17:36<tcsetattr>if you'd tell me what result you'd like to see as a result of shift-` then I could dig up the correct command for you. since you haven't said, I'm not going to guess.
17:36<doobian>well, in other news: Slowest ping time goes to MoDaX (11.64s)
17:36<EmleyMoor>Dash with serif on right end
17:36<EmleyMoor>... and broken/thick pipe for AltGr-`
17:37<tcsetattr>Oy! that's not even proper ASCII, you're _really_ foreign
17:37<MoDaX>doobian: wrong
17:37<EmleyMoor>Also, UK pound sign on shift-3 and Euro on AltGr-4
17:38<doobian>MoDaX, Unless thats a set reply.
17:38<tcsetattr>I never heard of a "dash with serif" before. And though I've heard of an "AltGr", I never actually saw one.
17:38[~]tcsetattr goes looking for funky keysyms
17:38<EmleyMoor>tcsetattr: The right Alt key is AltGr - on a US keyboard it may still be marked Alt, but AltGr-E should give you Euro
17:38<MoDaX>doobian: no. but konvi was too busy doing startup /who etc.
17:39<doobian>Aaah, ok.
17:39|-|Tombar_uy [~tombar@r190-64-48-231.dialup.adsl.anteldata.net.uy] has joined #debian
17:40<tcsetattr>RightAlt-E in my xterm gives a lowercase A with a circle on it. But we're getting sidetracked...
17:40|-|alp_ [~alp@gad13-2-82-231-179-70.fbx.proxad.net] has joined #debian
17:40<tcsetattr>/usr/include/X11/keysymdef.h is where I'm looking, and the only dashes I see are emdash, endash, and figdash
17:41|-|visik7 [~dksakd@host186-140-dynamic.58-82-r.retail.telecomitalia.it] has quit [Remote host closed the connection]
17:41|-|donfed1 [~grauf@castor.rfa.org] has quit [Quit: Leaving.]
17:41|-|dutche [~dutche@200.169.133.98] has quit [Remote host closed the connection]
17:42<tcsetattr>is it the same as the "not sign", U+00AC?
17:42<EmleyMoor>tcsetattr: It may be
17:43|-|qbit [~abieber@inet-netcache3-o.oracle.com] has quit [Quit: leaving]
17:43|-|tcgetattr [pacman@dialup-4.252.232.247.Dial1.Cincinnati1.Level3.net] has joined #debian
17:44|-|MoDaX [~nth@lan-84-240-22-131.vln.skynet.lt] has quit [Read error: Connection reset by peer]
17:44<tcgetattr>oops, I got disconnected right at the interesting part. What did I miss?
17:44<EmleyMoor>Got"sterling" back
17:44<EmleyMoor>It may be thenot" sign
17:45<tcgetattr>last thing I tried to send before losing it was: "is it the same as the "not sign", U+00AC?"
17:45<EmleyMoor>How do I define the AltGr character for a key?
17:45<EmleyMoor>It may be that
17:45|-|MoDaX [~nth@84.240.22.131] has joined #debian
17:45<EmleyMoor>Yes, it is
17:46<tcgetattr>do you have any keys that are working correctly with altgr? if so, look through the xmodmap -pke output to see how they're defined
17:46<EmleyMoor>No, I don't
17:46<tcgetattr>in what context do you use that "not sign"? is it actually an abbreviation for "not", like the ampersand is an abbreviation for "and"? people write it in the middle of a normal sentence?
17:47|-|Tombar [~tombar@r190-64-3-74.dialup.adsl.anteldata.net.uy] has quit [Ping timeout: 480 seconds]
17:47<EmleyMoor>I also can't Ctrl-Alt-Fn out of X
17:47<EmleyMoor>tcgetattr: I haven't used it for years but it is one of the mathematical symbols for a logical "not"
17:47<tcgetattr>sounds like you got a really messed up keyboard map somehow. probably better to find out why and fix that, than try to restore every key's functionality individually
17:47<tcgetattr>ok, only in math papers then, I can buy that
17:47<EmleyMoor>tcgetattr: That's all I *want* to do#
17:49<doobian>Does anyone know how I can get vmware server console to tell me which thread the vm is on the host?
17:49<tcgetattr>what are the "xkb" settings in your xorg.conf
17:49|-|d0rt [~ni@69.177.45.213] has joined #debian
17:50|-|tcsetattr [pacman@dialup-4.224.135.198.Dial1.Cincinnati1.Level3.net] has quit [Ping timeout: 480 seconds]
17:50|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
17:50|-|tcgetattr changed nick to tcsetattr
17:50<tcsetattr>grep -i xkb /etc/X11/*
17:50<EmleyMoor>http://www.pastebin.ca/631411
17:51<EmleyMoor>How do I refer to the Euro sign?
17:51|-|popeye [~fhwro@69.15.81.122] has quit [Remote host closed the connection]
17:54<tcsetattr>I see "EcuSign" and "EuroSign", don't know what the difference is
17:54<EmleyMoor>I see... still, can't make the AltGr key actually work with it anyway
17:54<tcsetattr>corresponding to "EURO-CURRENCY SIGN" and "EURO SIGN" in unicode.
17:55|-|Trashynovel changed nick to Recipebook
17:56|-|GhostlyDeath changed nick to GhostlyDeath_
17:56<EmleyMoor>I've obviously acquired a hosed keymap from somewhere... getting the right one may be helpfu;
17:56<EmleyMoor>helpful
17:56|-|DocTrax [~PHP@p5B12C1F4.dip0.t-ipconnect.de] has quit [Quit: INIT 0]
17:57|-|smeding [~roysmedin@c514451cb.cable.wanadoo.nl] has quit [Ping timeout: 480 seconds]
17:57<tcsetattr>the Xorg.0.log have any complaints? or did we cover that already... I forgot
17:58<EmleyMoor>No complaints
17:58|-|GhostlyDeath_ changed nick to GhostlyDeath
17:59|-|mode/#debian [+l 301] by debhelper
17:59<tcsetattr>where does it get those xkb files from... I don't see any pc105 in /etc/X11/xkb/*
18:00<EmleyMoor>tcsetattr: Must be standard locations as I have not done anything non-standard
18:00<doobian>bbiab
18:00|-|doobian [~Grey@host86-141-103-131.range86-141.btcentralplus.com] has quit [Quit: Leaving]
18:01|-|clinton_--- [~clinton_-@82-39-93-6.cable.ubr04.jarr.blueyonder.co.uk] has joined #debian
18:01|-|clinton_--- [~clinton_-@82-39-93-6.cable.ubr04.jarr.blueyonder.co.uk] has left #debian []
18:01|-|modax_ [~modax@84.240.22.131] has joined #debian
18:01|-|ao2 [~u@2001:1418:117::1] has quit [Quit: Leaving]
18:01|-|modax_ [~modax@84.240.22.131] has quit [Remote host closed the connection]
18:01|-|GhostK [~glauber_o@200.129.202.44] has joined #debian
18:02|-|GhostK [~glauber_o@200.129.202.44] has left #debian []
18:02<tcsetattr>I haven't had to deal with this type of problem before so I'm just trying to gather up knowledge of how the default keymap gets loaded.
18:03<EmleyMoor>All I can give you is "as normal" - whatever normal is
18:03|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has joined #debian
18:03|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has left #debian []
18:03|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has joined #debian
18:04<tcsetattr>I'm sure it's not "normal" for a Debian installation with "layout uk" to have so many problems. Unless your keyboard is atypical for the region
18:06<EmleyMoor>It's only recently (but I can't say HOW recently) broken
18:06|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
18:08|-|Recipebook changed nick to Trashynovel
18:09|-|dwon [~dwon@static24-89-65-166.regina.accesscomm.ca] has quit [Quit: Leaving]
18:09<tcsetattr>aha!
18:10<tcsetattr>I found something interesting. Here's my new theory: change "uk" to "gb" in the xorg.conf, see if that loads the right thing.
18:11<tcsetattr>there's a /etc/X11/xkb/symbols/gb that looks like it has most of what you're missing
18:11<EmleyMoor>OK - back in a Bristow
18:11|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has quit [Quit: leaving]
18:12|-|eliadosom [~Herr@168.Red-83-32-165.dynamicIP.rima-tde.net] has quit [Remote host closed the connection]
18:13|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has joined #debian
18:13<tcsetattr>it appears that X server quietly accepts misspelled and otherwise nonexistent "XkbLayout" specifications, leaving no clue to what is wrong
18:14<EmleyMoor>Yes. Now I capound/euro on my keyboard to my heart's content
18:14<EmleyMoor>can pount.
18:14<EmleyMoor>can pound/euro even
18:15<tcsetattr>poor GB, stuck with a 2-letter country code it doesn't really want.
18:16[~]EmleyMoor wishes the pound would go
18:17<EmleyMoor>I don't mind being gb... just wish they'd given us a caveat
18:17<tcsetattr>the top-level domain name .uk is the caveat :)
18:18<tcsetattr>then you can start calling # the "pound sign" like us
18:18<EmleyMoor>That's not a pound sign - it's an octothorpe
18:18<dondelelcaro>wha?
18:18|-|Wei [~weiwei@roko.stud.uni-goettingen.de] has joined #debian
18:19<dondelelcaro>I've heard it called pound or hash (and sometimes incorrectly sharp) but never that.
18:19<EmleyMoor>= is a quadrathorpe and - is a bithorpe
18:19<tcsetattr>octothorpe is a name someone made up to end the fighting over what to call it.
18:19<stew>i've definately heard octothorpe
18:19<stew>around the time i started hearing interrobang all the time
18:20<EmleyMoor>bash-bang-splat
18:20<Wei>hello, everybody
18:20<EmleyMoor>sh'bang
18:20|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
18:20<tcsetattr># is just the sh-, ! is bang
18:20<tcsetattr>any keys left not working the way you want them?
18:21<Wei>does anyone know, how to change the font color in latex?
18:21<dondelelcaro>yes
18:21<EmleyMoor>Apart from the (expected) crap they give in irssi, no
18:21|-|german [~german@r190-64-115-169.dialup.adsl.anteldata.net.uy] has joined #debian
18:21<Wei>can anyon help me
18:22|-|lupine_ [lupine@nick.lupine.me.uk] has quit [Read error: Connection reset by peer]
18:22<dondelelcaro>Wei: yes, someone can... you want \usepackage{xcolor} \textcolor{blahblahblah}{}
18:23<Wei>dondelelcaro: thanks a lot
18:24|-|EmleyMoor [phil@topdeck.tinsleyviaduct.com] has quit [Quit: leaving]
18:25|-|emonge [~emonge@168.243.176.133] has quit [Ping timeout: 480 seconds]
18:27|-|LightKnight [~gabry@adsl-ull-173-180.41-151.net24.it] has quit [Quit: Client exiting]
18:28|-|alfredo [~alfredo@r190-64-84-8.dialup.adsl.anteldata.net.uy] has joined #debian
18:31|-|Wei [~weiwei@roko.stud.uni-goettingen.de] has quit [Quit: Leaving]
18:31|-|alfredo [~alfredo@r190-64-84-8.dialup.adsl.anteldata.net.uy] has quit []
18:31|-|Wei [~weiwei@roko.stud.uni-goettingen.de] has joined #debian
18:31<Wei>join #wei
18:31|-|Wei [~weiwei@roko.stud.uni-goettingen.de] has quit []
18:32|-|fixxxer [~aavelar@189.135.136.77] has quit [Remote host closed the connection]
18:33|-|themill [~stuart@86.53.48.59] has quit [Ping timeout: 480 seconds]
18:33|-|lupine_85 [lupine@nick.lupine.me.uk] has joined #debian
18:34|-|Larri [~alfredo@r190-64-84-8.dialup.adsl.anteldata.net.uy] has joined #debian
18:35|-|Cave` [~cave@0x5735d6ed.vgnxx4.adsl-dhcp.tele.dk] has quit [Remote host closed the connection]
18:35|-|Wei [~weiwei@roko.stud.uni-goettingen.de] has joined #debian
18:35|-|Wei [~weiwei@roko.stud.uni-goettingen.de] has quit []
18:36|-|juliank [~juliank@Q7b7b.q.strato-dslnet.de] has quit [Remote host closed the connection]
18:37|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
18:37|-|Larri_ [~alfredo@r190-64-84-8.dialup.adsl.anteldata.net.uy] has joined #debian
18:37|-|Larri [~alfredo@r190-64-84-8.dialup.adsl.anteldata.net.uy] has left #debian []
18:38|-|Larri_ [~alfredo@r190-64-84-8.dialup.adsl.anteldata.net.uy] has left #debian []
18:39|-|mode/#debian [+l 293] by debhelper
18:39|-|lunatic [~lunatic@ARennes-351-1-70-124.w86-199.abo.wanadoo.fr] has joined #debian
18:41|-|lsb [~lsb@22.172.110-65.q9.net] has quit [Ping timeout: 480 seconds]
18:44|-|rhoruns [~rhoruns@ip68-230-90-30.ph.ph.cox.net] has joined #debian
18:45|-|freezombie [someone@pD9E3231E.dip.t-dialin.net] has quit [Quit: Lost terminal]
18:46|-|maximiliano [maximilian@190.55.95.177] has joined #debian
18:48|-|maximiliano [maximilian@190.55.95.177] has left #debian []
18:56|-|lunatic [~lunatic@ARennes-351-1-70-124.w86-199.abo.wanadoo.fr] has quit [Quit: Quitte]
18:57|-|betobz [humberto@cm-net-cwb-C8B03684.dynamic.brdterra.com.br] has joined #debian
19:00|-|Fattihvalos [~fader@0x5550acb4.adsl.cybercity.dk] has quit []
19:00|-|bzed [~bzed@dslb-084-059-110-198.pools.arcor-ip.net] has quit [Quit: Leaving]
19:03|-|Ten [~ten@88-96-94-193.dsl.zen.co.uk] has quit [Remote host closed the connection]
19:03|-|Ten [~ten@88-96-94-193.dsl.zen.co.uk] has joined #debian
19:03|-|lupine [lupine@nick.lupine.me.uk] has joined #debian
19:04|-|lupine_85 [lupine@nick.lupine.me.uk] has quit [Read error: Connection reset by peer]
19:05|-|velixzeen [~velixzeen@216.36.141.104] has joined #debian
19:05|-|Sub-Zero [~Sub-Zero@190.38.177.24] has joined #debian
19:07|-|velixzeen [~velixzeen@216.36.141.104] has quit []
19:09|-|lambda [~lambda@88-136-64-10.adslgp.cegetel.net] has quit [Remote host closed the connection]
19:10|-|jae [~jae@d253028.dialin.hansenet.de] has quit [Ping timeout: 480 seconds]
19:12|-|tbrock [tbrock@ool-18bd297a.dyn.optonline.net] has joined #debian
19:12<tbrock>hey guys how do i change my site in apache from mysite.com/blog to mysite.com
19:12<tbrock>i tried editing the sites-available file for wordpess
19:13<tbrock>but it just says permission denied when i try to access mysite.com
19:17|-|xlq [~xlq@mtxf.net] has quit [Remote host closed the connection]
19:17<litage>tbrock: that's not a very descriptive question. you haven't provided any information regarding how you've configured apache, nor which version of apache you're running. a wild guess with what you've provided so far would be to add "/blog" to the end of your document root setting
19:17|-|xlq [~xlq@mtxf.net] has joined #debian
19:17|-|kintaro0e [~kintaro0e@cebu.exist.com] has joined #debian
19:17|-|jack_wyt_ [~jack@124.64.111.214] has joined #debian
19:17|-|CosmicRay [~jgoerzen@ip2.fa1-0-2.occ.iinet.com] has quit [Quit: Client exiting]
19:18<tbrock>i want to get rid of the /blog
19:18<tbrock>so that it goes to my blog when i just visit mysite.com
19:18<litage>tbrock: right, you already explained that
19:18<tbrock>i have apache 2
19:18<tbrock>i had this: Alias /blog /usr/share/wordpress
19:18<tbrock>but i changed it to this
19:18<tbrock>i had this: Alias / /usr/share/wordpress
19:18<tbrock>and when i try to visit mysite.com
19:19<tbrock>it says permission denied
19:19<litage>tbrock: i don't know if you can set an alias for the root dir
19:19|-|morpheus__ [~morpheus@DSL01.83.171.168.204.ip-pool.NEFkom.net] has quit [Quit: Verlassend | Debian GNU/Linux rules]
19:20<litage>tbrock: try what i suggested, and get rid of that alias line completely
19:21<Supaplex>is umsdos all but forgotten? Which of fat12, fat16 and fat32 does it support?
19:21|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
19:21<tbrock>ok, then how will it know where to go
19:21<tbrock>can i comment it out
19:21<tbrock>with a #?
19:22<litage>tbrock: yes, you comment out lines in apache config files with a hash ("#")
19:22<tbrock>ok tight
19:22<litage>tbrock: apache should know "where to go" from the document root setting
19:22<tbrock>now it says requested url not found on this server
19:22<Supaplex>tbrock: what's the apache error log say? do you want your blog to run at mysite.com or mysite.com/blog or neither?
19:22|-|Roy [~Roy@74.197.30.153] has joined #debian
19:22<litage>tbrock: what did you set your document root to?
19:22<tbrock>mysite.com
19:22<tbrock>is where i want it
19:23<Supaplex>tbrock: look in /var/log/apache*/error.log
19:23<tbrock>in the sites-available/wordpress file, it has <Directory /usr/share/wordpress>
19:23<tcsetattr>umsdos isn't even in the latest kernel anymore. I think it's been gone for a couple of years. And it was pretty much forgotten long before that.
19:23<tbrock>maybe i should just change where the default site goes
19:23[~]litage shakes his head
19:23<litage>tbrock: that's what i've been telling you to do
19:23<Supaplex>haha cool.
19:24<tbrock>ok, but it kinda messes up this site infrastucture
19:26<Supaplex>just kindof huh
19:26<Supaplex>so much for the apache error log.
19:26[~]Supaplex heads out into the real world for some errands
19:27<tbrock>litage: ok should i edit the document root, cause i feel like that will mess a lot of stuff up
19:27<tbrock>or should i edit the directory for slash
19:29<tbrock>maybe this should be done with virtual hosts
19:29<litage>tbrock: "mess a lot of stuff up"? mess up what? so far you've only mentioned a wordpress site, so we don't know what might be "messed up"
19:29<tbrock>well there is all this default stuff in theere
19:30<tbrock>like the document root points to /var/www
19:30<tbrock>so i don't know if i should change that
19:30<tbrock>basically what i'm asking is if this is the proper way to do this
19:30<tbrock>i feel like i should be changing the document root
19:32<tcsetattr>oh just use a redirector already
19:32<litage>tbrock: do you have anything besides wordpress in your site?
19:32<tbrock>no
19:32<tbrock>but i want to do this the correct "debian way"
19:32<tbrock>so that i may add them later
19:33<tbrock>and would like to know what i need to do, whether it be setup a virtual site or whatever
19:33<tbrock>i don't know
19:33<tbrock>litage: thanks for helping me
19:33<litage>tbrock: there's more than one way to do this. there isn't one "Debian Way"
19:33<tbrock>ok
19:33<tbrock>so what is the cleanest way to accomplish this
19:34<litage>tbrock: the only "Debian Way" for doing what you're doing is to setup your websites in their own config files within /etc/apache2/sites-available/
19:34|-|fiord [~alexander@manz-590cdd08.pool.einsundeins.de] has joined #debian
19:34<fiord>!de
19:34<dpkg>somebody said de was deutschsprachige Hilfe bekommt ihr in #debian.de (auf irc.oftc.net und irc.freenode.net) - German speaking users please go to #debian.de (on irc.oftc.net and freenode)
19:34<litage>tbrock: if you want to adhere to the FHS (filesystem heirarchy standard) with respect to where your wordpress files should be, then please read the FHS
19:35|-|fiord [~alexander@manz-590cdd08.pool.einsundeins.de] has left #debian []
19:35|-|tolecnal [~tolecnal@158.80-203-128.nextgentel.com] has quit [Quit: upgrade of nvidia driver...]
19:36<litage>tbrock: however, if you've installed apache2, wordpress and their dependencies via apt/dpkg/aptitude , i'd either set the document root to wordpress' directory, or create a virtual host rooted at wordpress' directory
19:36|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
19:36|-|fiord_ [~alexander@manz-590cdd08.pool.einsundeins.de] has joined #debian
19:37<fiord_>Hello?
19:37<litage>fiord_: wie geht's
19:37<fiord_>Is there anybody?
19:37<fiord_>Gut ^^
19:38<fiord_>Warum istn hier deutsch?
19:39<fiord_>can anybody help me with this? -> http://img71.imageshack.us/img71/8581/bildschirmfotoja3.png It happens when i try to access my Notebook (its running fluxbox and vnc4server)
19:39|-|NightMonkey [~NightMonk@nightmonkey.user.oftc.net] has quit [Ping timeout: 480 seconds]
19:39|-|german [~german@r190-64-115-169.dialup.adsl.anteldata.net.uy] has quit [Ping timeout: 480 seconds]
19:40<tbrock>ok, how would i got about making a virtual host at that directory
19:40|-|linux-fox [~linux-fox@60.218.58.70] has joined #debian
19:41<litage>fiord_: please speak english in this channel. if you'd like to speak german, please go to #debian.de
19:41<fiord_>yes its ok
19:41<litage>tbrock: read up on it. google's your friend =)
19:41<litage>tbrock: there are plenty of articles, HOWTOs, tutorials, documentation, etc on the matter
19:42<fiord_>litage can you help me with my problem?
19:42|-|Daws [~Daws@88-105-10-143.dynamic.dsl.as9105.com] has joined #debian
19:42<fiord_>hi linux-fox
19:42<litage>fiord_: sorry, i've never used fluxbox or vnc4server
19:42<fiord_>mhm ok
19:42<litage>and i must get back to work... =P
19:43<aricz>Hi, I'm just wondering if anyone know if there's a way to get the "block"chars in virtual console .. not sure how to describe those characters, but here's a link : "http://www.roysac.com/roy_ansidetail.asp?f=ROY%2DLLA%2EASC&src=a&pg=9"
19:43<fiord_>oh ^^ here in germany its 2:45 am
19:44|-|e-t172 [e-t172@81.34.100-84.rev.gaoland.net] has quit [Read error: Connection reset by peer]
19:44<fiord_>Please help me xD
19:44<linux-fox>fiord, hello
19:45<fiord_>hey do you know me linux-fox? ^^ i know you =P
19:45<linux-fox>fiord, sorry , are you my friend in the jabber?
19:46<fiord_>in msn yes ^^
19:47<fiord_>can anybody help me with this? -> http://img71.imageshack.us/img71/8581/bildschirmfotoja3.png It happens when i try to access my Notebook (its running fluxbox and vnc4server)
19:47<linux-fox>fiord:ok , nice to meet you ,my friend
19:47<fiord_>thx nice to meet you too
19:48|-|EatMoreAltoids [~nik@hogwarts.lifeafterking.org] has joined #debian
19:48|-|EatMoreAltoids changed nick to altoid
19:50<linux-fox>fiord: what are you doing?
19:52<linux-fox>?
19:52|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
19:53|-|janrocks [~janrocks@82-33-137-88.cable.ubr02.wiga.blueyonder.co.uk] has quit [Remote host closed the connection]
19:54|-|emonge [~emonge@201.247.69.2] has joined #debian
19:55<fiord_>im trying to use vnc
19:57<fiord_>but it doesnt work
19:59|-|Roy [~Roy@74.197.30.153] has quit [Quit: Leaving]
19:59<tbrock>how do you scroll up in irssi?
20:00|-|ZoKeBeR [~zokeber@190.72.27.242] has joined #debian
20:00|-|myles [~myles@bas10-toronto12-1096758579.dsl.bell.ca] has quit [Remote host closed the connection]
20:01<tbrock>how do you scroll up in irssi?
20:01<tbrock>does anyone know
20:01<chealer>tbrock: ask #irssi
20:01<tbrock>ok
20:01<tbrock>ok i was looking for a quick answer
20:01<fiord_>can anybody help me with this? -> http://img71.imageshack.us/img71/8581/bildschirmfotoja3.png It happens when i try to access my Notebook (its running fluxbox and vnc4server)
20:02|-|gravity [~david@dsl092-079-075.bos1.dsl.speakeasy.net] has joined #debian
20:02|-|manphiz [dxy@218.244.247.198] has joined #debian
20:03|-|myles [~myles@bas10-toronto12-1096758579.dsl.bell.ca] has joined #debian
20:03<chealer>fiord_: this is a Debian support channel.
20:03|-|myles [~myles@bas10-toronto12-1096758579.dsl.bell.ca] has quit []
20:03<fiord_>what did i do wrong?
20:06<chealer>fiord_: don't ask questions about Ubuntu here.
20:06|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
20:08|-|Optical [~dlz@125.126.194.2] has joined #debian
20:09|-|tolecnal [~tolecnal@158.80-203-128.nextgentel.com] has joined #debian
20:10|-|Anchor [~Anchor@200.234.87.31] has joined #debian
20:10|-|manel [~manel@189.134.170.207] has joined #debian
20:10|-|mike [~mike@ip70-188-31-39.rn.hr.cox.net] has joined #debian
20:10<mike>whats up?
20:10|-|mike changed nick to KDEusr1
20:11<Aleric>How can I add a printer to debian?
20:11<KDEusr1>install the package cups
20:11<KDEusr1>im tryin to use GL on ppc debian
20:11<KDEusr1>is there a ATI fglrx driver for ppc deb?
20:12|-|fiord_ [~alexander@manz-590cdd08.pool.einsundeins.de] has quit [Ping timeout: 480 seconds]
20:13<Aleric>I mean... I ran some printer GUI things, and everything SEEMS to work: it detect my printer etc etc, but when I am done with the detection/installation/configuration of the printer - nothing has changed. No printer.
20:13|-|H [~h@tor-irc.dnsbl.oftc.net] has quit [Quit: Konversation terminated!]
20:14|-|dli_ [~dli@adsl-75-34-12-52.dsl.chcgil.sbcglobal.net] has joined #debian
20:14|-|node_3667 [~someone@modemcable073.151-202-24.mc.videotron.ca] has joined #debian
20:15|-|knoppix_ [~knoppix@d57-103-218.home.cgocable.net] has joined #debian
20:16<knoppix_>sup
20:16|-|Anchor [~Anchor@200.234.87.31] has left #debian [Leaving]
20:16<knoppix_>helo?
20:16|-|knoppix_ changed nick to Guest99
20:16<Guest99>hello?
20:17|-|knoppix__ [~knoppix@d57-103-218.home.cgocable.net] has joined #debian
20:17<knoppix__>hello\
20:18|-|knoppix__ changed nick to Guest100
20:19|-|mode/#debian [+l 299] by debhelper
20:19<Guest100><><><
20:19<Guest100>nm
20:19<Guest100>nuibn
20:19<Guest100>nhijbhlbyhbybhbhbhbhbhbhbhbhbhbhbhmknminyhvrfcedcrdrdrdrdrdrdrdr
20:19<Guest100>_____
20:20<Guest100>| \
20:20|-|rhoruns [~rhoruns@ip68-230-90-30.ph.ph.cox.net] has quit [Read error: Connection reset by peer]
20:20|-|dli [~dli@adsl-75-33-240-121.dsl.chcgil.sbcglobal.net] has quit [Ping timeout: 480 seconds]
20:20<Guest99>ygjf
20:21<miksuh>Guest100: don't sleep at the keyboard :)
20:21<Guest100>| hello
20:21<Aleric>Printing a test page doesn't do anything - but I can print from firefox
20:21<Guest100>im using knoppix 5.1.1
20:22|-|manel [~manel@189.134.170.207] has quit [Remote host closed the connection]
20:22<Guest100>lol
20:23<Guest100>im going to spell DSL (damn small linnux)
20:23|-|xilef [xilef@190.72.29.56] has joined #debian
20:23<Guest100>___
20:24<Guest100>| \
20:24<stew>Guest100: stop. do you have a debian related question
20:24<Guest100>yes
20:24<stew>Guest100: or if you want help with knoppix, please go to #knoppix on irc.freenode.net
20:24<stew>Guest100: if you have a question, ask it
20:24|-|xilef changed nick to Xz
20:25<Xz>hola todo el mundo
20:25<Xz>hi ALL
20:25|-|hon [~hon@128.100.244.150] has joined #debian
20:25<hon>where is lockfile ?
20:25<hon>!lockfile
20:26<hon>dpkg:lockfile
20:26<Guest100>idn
20:26<stew>hon: generally in /var/lock ; but whick lockfile in particular are you looking for?
20:26<tcsetattr>lockfile-progs?
20:26<Guest100>how big is the debian file?
20:26<stew>Guest100: which file?
20:26<hon>`which lockfile` gives me nothing
20:26<Guest100>all together
20:27<tcsetattr>apt-get install lockfile-progs
20:27|-|gar [~selif00@c-76-26-57-126.hsd1.fl.comcast.net] has quit [Ping timeout: 480 seconds]
20:27<stew>Guest100: what do you mean?
20:27<litage>Guest100: did you mean to ask "how big is the Debian install CD"?
20:27<Guest100>yes
20:27<tcsetattr>it's a few DVDs big.
20:27<litage>Guest100: it's a full CD. however, the network install CD is only like 150MB i think
20:27<Xz>hey can i aks about a cd extractor here
20:27<Xz>???
20:27<stew>Guest100: 21 cds
20:28<litage>nobody ever uses all of the CDs though
20:28<hon>tcsetattr: lockfile-progs provides lockfile-create, lockfile-remove and lockfile-touch. It does not provide lockfile.
20:28<stew>hon: what are you trying to do?
20:28<Guest100>where can i get knoppix 5.2.0
20:29<hon>stew : if lockfile -! -l 43200 -r 0 "$LOCK"; then
20:29<stew>Guest100: ask #knoppix on irc.freenode.net ; knoppix is offtopic here
20:29<hon>(part of the anonftpsync.txt)
20:29<litage>hon: the procmail package provides /usr/bin/lockfile ...
20:29<tcsetattr>oh, you must want the /usr/bin/lockfile from procmail
20:29<Guest100>are you a auto talk computer?
20:29<litage>hon: you could've figured that out for yourself with this command: apt-get install apt-file; apt-file update; apt-file search usr/bin/lockfile
20:29<Guest100>cuz if you are you are a sssssssssssmmmmmmmmmmmmaaaaart computer
20:30<stew>Guest100: please don't do that
20:30<Guest100>do wat?
20:30|-|Daws [~Daws@88-105-10-143.dynamic.dsl.as9105.com] has quit [Remote host closed the connection]
20:30|-|linux-fox [~linux-fox@60.218.58.70] has quit [Quit: Leaving]
20:30<hon>thanks. litage: thanks a lot
20:30<litage>hon: np
20:30<Guest100>stew: are you a computer or a human?
20:31<aricz>haha
20:31<litage>Guest100: are you a computer or a human?
20:31<Guest100>a human
20:31<stew>Guest100: do you have any other debian related questions?
20:31<Guest100>YOU ARE A COMPUTER! you talkfast
20:31<litage>Guest100: prove it
20:31<Guest100>just did
20:31<stew>Guest100: please keep it on-topic
20:32<Guest100>i am
20:32|-|Waddledee [~waddledee@c-24-18-0-114.hsd1.mn.comcast.net] has joined #debian
20:32<Xz>well i need to know if somebody knows about a cd extractor to transform files in mp3 or ogg????
20:33|-|jack_wyt_ [~jack@124.64.111.214] has quit [Ping timeout: 480 seconds]
20:33<Guest100>stew: are you a computer?
20:33<stew>Xz: for audio cds? cdparanoia
20:33<gravity>Xz: soundjuicer
20:33<Xz>oryes
20:33<aricz>I'll try again, do anyone know if there's possible to get the "block"chars in virtual console? Not sure how to explain this.. we had those ascii-characters in DOS .. :) anyone know what I mean?
20:33<Xz>yes
20:33<stew>Guest100: no, do you have any other debian related questions?
20:33|-|jack_wyt_ [~jack@124.64.111.214] has joined #debian
20:33<miksuh>Guest100: this is #debian, not #knoppix :)
20:33<CompWizrd>Guest100: surely it's not that boring in Windsor tonight that you need to be trolling here?
20:33<gravity>There's a kde one I forget the name of
20:34<tcsetattr>this one? kaudiocreator - CD ripper and audio encoder frontend for KDE
20:34<aricz>Xz: 'grip' is nice
20:34<gravity>tcsetattr: That's probably it
20:34<Guest100>stew: that is strange im from windsor too!
20:34<Xz><stew> thanks
20:34<gravity>aricz: I think grip is discontinued upstream
20:34<gravity>I loved it for many years though
20:34<litage>i accidentally hit CTRL+s rather than CTRL+d , and now one of my terminals is unresponsive. which key combo brings it back to life?
20:34<tcsetattr>aricz, as a first step, run "showcfont" on your console to see what characters are in your font.
20:34<Xz>goin to look
20:34<tcsetattr>litage, ^Q
20:35<litage>thaks
20:35<litage>thanks
20:35<aricz>tcsetattr : thanks.. strange, they're there..
20:36|-|Ten [~ten@88-96-94-193.dsl.zen.co.uk] has quit [Remote host closed the connection]
20:36<Xz> <tcsetattr> ok but one problem
20:36<Xz>i use gnome
20:37<tcsetattr>so... apt-cache search gnome cd ripper
20:38<Guest100>how come #knoppix is not a server?
20:38<Guest100>ANYONE! i need help!
20:38<aricz>hmm, so I have the ascii-characters, why do they show correctly in Xterm but not virtual console ?
20:39<aricz>same goes for roguelikes, they like to change the blockcharacters to '#' .. :)
20:39|-|avu [~jan@2001:6f8:13f7::1] has quit [Quit: leaving]
20:39|-|ZoKeBeR [~zokeber@190.72.27.242] has quit [Quit: huyendo]
20:39<KDEusr1>!fglrx ppc
20:40|-|avu [~jan@2001:6f8:13f7::1] has joined #debian
20:40<tcsetattr>doubtful that any proprietary software pushers are interested in PPC, especially since Apple started selling *86 botxen.
20:40<tcsetattr>s/bot/bo/
20:41|-|Guest100 [~knoppix@d57-103-218.home.cgocable.net] has quit [Quit: Leaving]
20:41|-|Guest99 [~knoppix@d57-103-218.home.cgocable.net] has quit [Quit: Leaving]
20:41|-|matta [~matt@bas2-kingston08-1167934782.dsl.bell.ca] has joined #debian
20:41<tcsetattr>aricz, first of all don't call things "ASCII" that aren't. ASCII is 95 printable characters and 33 control codes. none of them are block graphics. secondly, what are you using to print them?
20:41|-|bernardo [~bernardo@200.150.175.133] has joined #debian
20:42<bernardo>hey
20:42<aricz>tcsetattr : what are they called? Extended ascii ? I use 'cat' .. and trying to have a nice logo in /etc/issue
20:42|-|xuwei [xuwei@222.85.71.98] has joined #debian
20:43|-|CosmicRay [~jgoerzen@000-117-710.area2.spcsdns.net] has joined #debian
20:44<tcsetattr>well "cat" isn't the answer I'm looking for. What did you use to create the file you're cat'ing?
20:44<blarson>aricz: They are called by the name of the character set. There are thousands of different incomatable "extended ascii" character sets.
20:45|-|binaryluo [~binluo@222.219.132.184] has joined #debian
20:45<aricz>I get the ascii-art from the net..
20:47|-|hazard2 [~hazard@71.174.54.250] has quit [Quit: This computer has gone to sleep]
20:47<tcsetattr>"ascii" art with non-ascii characters in it
20:47|-|german [~german@r190-64-115-169.dialup.adsl.anteldata.net.uy] has joined #debian
20:48|-|rbrito [~rbrito@201.76.27.2] has joined #debian
20:48|-|Xz [xilef@190.72.29.56] has quit [Remote host closed the connection]
20:48<aricz>oh, they call it 'high-ascii' I see
20:49<tcsetattr>yeah, "extended ascii" and "high ascii" are nonsense terms spoken by ignorant DOS users who don't know what they're talking about. if you can't identify the codepage you won't be able to display the file correctly
20:50<aricz>"The so called "block ASCII" or "high ASCII" uses the extended characters of the 8-bit code page 437, which is a proprietary standard that was introduced by IBM in 1979 (ANSI Standard x3.16) for the IBM PC and MS DOS operating system in an effort to standardize graphic character representations and cursor control."
20:50<aricz>sorry, I didn't know what to look for in the first place
20:50|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
20:52|-|Hessophanes [~jcn@dslb-088-073-051-180.pools.arcor-ip.net] has quit [Quit: SIGSLEEP]
20:54|-|myles [~myles@bas10-toronto12-1096758579.dsl.bell.ca] has joined #debian
20:54<tcsetattr>the trouble with funky-DOS ascii art is not just the font but also the fact that it assigns graphics to certain code points, that can't be printed directly on the Linux console because they're always taken as control characters (carriage return, formfeed..
20:55<tcsetattr>showcfont puts the console into unicode mode to access those weird graphics.
20:56<tcsetattr>if you convert your cp437 file to utf8 you could just cat it directly in unicode mode
20:56|-|klys_ [~admini@72.8.101.65] has quit [Ping timeout: 480 seconds]
20:57<tcsetattr>ESC[11m enables some of the control characters to be printed as graphics but not all of them
20:58<tcsetattr>man, everybody went quiet
21:00<Waddledee>It's usually pretty quiet here, unless someone has a problem... and sometimes even then. Depends on whether anyone has a solution or not.
21:02|-|specialized [~specializ@bl5-200-208.dsl.telepac.pt] has joined #debian
21:03|-|specialized [~specializ@bl5-200-208.dsl.telepac.pt] has quit [Remote host closed the connection]
21:05|-|alp_ [~alp@gad13-2-82-231-179-70.fbx.proxad.net] has quit [Quit: ++]
21:05|-|craigevil [~craigevil@96.144.205.68.cfl.res.rr.com] has joined #debian
21:05|-|alp_ [~alp@gad13-2-82-231-179-70.fbx.proxad.net] has joined #debian
21:05|-|ibu [~ibu@e180241181.adsl.alicedsl.de] has quit [Ping timeout: 480 seconds]
21:06|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
21:09|-|thomasbl [~thomasbl@85.179.25.10] has quit [Ping timeout: 480 seconds]
21:11|-|CosmicRay [~jgoerzen@000-117-710.area2.spcsdns.net] has quit [Quit: Client exiting]
21:12|-|bernardo [~bernardo@200.150.175.133] has left #debian []
21:14|-|ibu [~ibu@e179200157.adsl.alicedsl.de] has joined #debian
21:17|-|velixzeen [~velixzeen@216.36.141.104] has joined #debian
21:17<velixzeen>Does a package repository automatically supply what apt-file needs to list package contents?
21:18<tcsetattr>I think it just needs the Contents-$ARCH.gz
21:18<velixzeen>I've added a repo for e17, can install from it, but apt-file list e17 returns nothing
21:18<velixzeen>hello, tcsetattr
21:19<tcsetattr>did you apt-file update after adding it?
21:19|-|Requiem [kc@c-67-186-239-161.hsd1.ut.comcast.net] has quit [Remote host closed the connection]
21:19<velixzeen>yes update completed w/o error
21:19|-|hon [~hon@128.100.244.150] has left #debian []
21:20|-|thomasbl [~thomasbl@e179018106.adsl.alicedsl.de] has joined #debian
21:21<velixzeen>apt-file is fine with packages from other repos. could problem be that 'e17' is a virtual package?
21:21<tcsetattr>take a peek in /var/cache/apt/apt-file/ and see what's in there.
21:22<velixzeen>k
21:23|-|Waddledee [~waddledee@c-24-18-0-114.hsd1.mn.comcast.net] has quit [Quit: *wanders*]
21:23<velixzeen>ahhh, there are files for the other repos, but not the edevelop.org repo.
21:24<tcsetattr>apt-file update should have put something there
21:24<velixzeen>yes
21:24|-|rjent_ [~rjent@dpc6935167142.direcpc.com] has joined #debian
21:24<velixzeen>perhaps apt-file can be more verbose and let me know the problem
21:24<rjent_>Greetings, can anyone offer ideas on a POS+inventory software that runs on debian?
21:25<rjent_>I have a small company that has outgrown the simple software I have written.
21:26|-|alvarezp [~alvarezp@201.160.193.87.cable.dyn.cableonline.com.mx] has joined #debian
21:26|-|gravity [~david@dsl092-079-075.bos1.dsl.speakeasy.net] has quit [Quit: sleep]
21:26<velixzeen>yep, echo "http://edevelop.org/debian/dists/sid/Contents-i386.gz not found"
21:27<tcsetattr>so I guess that means the answer to the original question is no... not all repositories have the necessary stuff for apt-file to work
21:28<velixzeen>thanks tcsetattr, looks like that. I have a habit of using sid/unstable interchangably in sources.list, that is always ok?
21:28<velixzeen>just wondering
21:29|-|faw [~felipe@200-181-176-94.ctame705.dsl.brasiltelecom.net.br] has joined #debian
21:30|-|realniko [~realniko@ALamentin-105-1-33-29.w90-31.abo.wanadoo.fr] has joined #debian
21:31<tcsetattr>yeah, they're permanently interchangeable
21:31<velixzeen>k
21:38|-|OMEGA303 [~luis@63.245.39.188] has joined #debian
21:38|-|manel [~manel@189.134.170.207] has joined #debian
21:38<velixzeen>thanks tcsetattr, makes sense now :)
21:40|-|OMEGA303 [~luis@63.245.39.188] has quit []
21:40|-|E0x [~moya@tdev252-5.codetel.net.do] has quit [Quit: off]
21:40|-|rjent_ [~rjent@dpc6935167142.direcpc.com] has quit [Quit: Leaving]
21:41|-|rodrigo [~rodrigo@189.29.125.130] has joined #debian
21:41<rodrigo>algum br ae?
21:43<stew>!br
21:43<dpkg>Este canal é apenas em inglês. Por favor, use #debian-br (/j #debian-br) para ajuda em portugues.
21:44|-|rodrigo [~rodrigo@189.29.125.130] has quit []
21:45|-|MoDaXaS [~nth@84.240.22.131] has joined #debian
21:46|-|MoDaX [~nth@84.240.22.131] has quit [Read error: Connection reset by peer]
21:49|-|abrotman [~abrotman@c-71-230-49-187.hsd1.pa.comcast.net] has quit [Remote host closed the connection]
21:50|-|cparker [~cparker@c-71-232-128-152.hsd1.ma.comcast.net] has joined #debian
21:51|-|woal [~colson@bb116-14-29-142.singnet.com.sg] has joined #debian
21:51|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
21:51|-|rbrito [~rbrito@201.76.27.2] has left #debian [Leaving]
21:52<woal>got this error when i run 'apt-get update': W: GPG error: http://security.debian.org testing/updates Release: The following signatures were invalid: BADSIG A70DAF536070D3A1 Debian Archive Automatic Signing Key (4.0/etch) <ftpmaster@debian.org>
21:52<woal>W: You may want to run apt-get update to correct these problems
21:52|-|lupine_ [lupine@nick.lupine.me.uk] has joined #debian
21:53<woal>what could be the problem? it is not serious since it is only a warning, right?
21:53|-|lupine [lupine@nick.lupine.me.uk] has quit [Read error: Network is unreachable]
21:54<woal>heh?
21:55|-|woal [~colson@bb116-14-29-142.singnet.com.sg] has quit []
21:58|-|`villain` [~villain@83.146.91.195] has joined #debian
21:59|-|Atomo64 [~Atomo64@200.92.151.48] has quit [Remote host closed the connection]
22:04|-|`villain` [~villain@83.146.91.195] has quit [Quit: ðÏËÉÄÁÀ]
22:05|-|aricz [~aricz@97.80-202-19.nextgentel.com] has quit [Quit: BitchX-1.1-final -- just do it.]
22:06|-|saapas [~saapas@hoas-fe1bdd00-98.dhcp.inet.fi] has quit [Ping timeout: 480 seconds]
22:07|-|lupine_ [lupine@nick.lupine.me.uk] has quit [Ping timeout: 480 seconds]
22:07|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
22:08|-|CutMeOwnThroat [k@dhcp098175.res-hall.northwestern.edu] has joined #debian
22:08|-|aricz [~aricz@97.80-202-19.nextgentel.com] has joined #debian
22:09|-|mode/#debian [+l 292] by debhelper
22:12|-|lupine_ [lupine@nick.lupine.me.uk] has joined #debian
22:15|-|german [~german@r190-64-115-169.dialup.adsl.anteldata.net.uy] has quit [Ping timeout: 480 seconds]
22:19|-|Holborn [~holborn@237.Red-217-125-137.staticIP.rima-tde.net] has quit [Quit: Lost terminal]
22:20|-|lupine_ [lupine@nick.lupine.me.uk] has quit [Ping timeout: 480 seconds]
22:22|-|realniko [~realniko@ALamentin-105-1-33-29.w90-31.abo.wanadoo.fr] has quit [Quit: Quitte]
22:22|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
22:23|-|myles [~myles@bas10-toronto12-1096758579.dsl.bell.ca] has quit [Remote host closed the connection]
22:27|-|d0rt [~ni@69.177.45.213] has quit [Quit: Konversation terminated!]
22:29|-|mode/#debian [+l 286] by debhelper
22:30|-|CutMeOwnThroat [k@dhcp098175.res-hall.northwestern.edu] has quit [Remote host closed the connection]
22:30|-|kanru [~kanru@2001:e10:6840:19:212:f0ff:fe21:3332] has joined #debian
22:30|-|CutMeOwnThroat [k@dhcp098175.res-hall.northwestern.edu] has joined #debian
22:30|-|deliver [~deliver@dslnet.85-22-17.ip106.dokom.de] has joined #debian
22:32|-|binaryluo [~binluo@222.219.132.184] has left #debian [退出!]
22:32|-|NightMonkey [~NightMonk@nightmonkey.user.oftc.net] has joined #debian
22:36|-|lupine_ [lupine@nick.lupine.me.uk] has joined #debian
22:37|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
22:40|-|Sub-Zero [~Sub-Zero@190.38.177.24] has quit [Quit: sortadi :-)]
22:41|-|betobz [humberto@cm-net-cwb-C8B03684.dynamic.brdterra.com.br] has quit [Quit: Leaving]
22:41|-|roughneck [~ama7@203.87.187.54] has joined #debian
22:42<roughneck>any one here knows how to make server a GUI???
22:42<roughneck>any one here knows how to make server a GUI???\
22:43|-|roughneck [~ama7@203.87.187.54] has quit []
22:44|-|mike [~Nutz@66.16.30.134] has joined #debian
22:44<mike>i need help
22:44<mike>anyone here?
22:45<velixzeen>yes
22:45<mike>sweet ok
22:45<mike>i use knoppix but im having some trouble
22:45<velixzeen>?
22:45<mike>i do alot of internet chating but i cant get audio from the live chat
22:46<mike>any idea how to make it so my mic and speakers will work in the chat room
22:46|-|noname001__ [~pawel@82-32-102-47.cable.ubr01.hawk.blueyonder.co.uk] has joined #debian
22:47<mike>i guess not
22:47<velixzeen>well not really
22:47<mike>hmmm
22:47<mike>i dont get why it doesnt work
22:47<velixzeen>likely a question for a knoppix channel
22:48|-|noname001 [~pawel@82-32-102-47.cable.ubr01.hawk.blueyonder.co.uk] has quit [Read error: Connection reset by peer]
22:48|-|esaym [~user@cpe-72-183-198-134.satx.res.rr.com] has quit [Remote host closed the connection]
22:48<mike>well i figured any linux stand point would help but thank you any way
22:48<velixzeen>any sound work?
22:48<peterS>how to set up kernel module loading (which is probably, though not certainly, your issue) in different distributions is going to be different
22:48|-|juancgt [~juancgt@c-76-17-127-141.hsd1.ga.comcast.net] has joined #debian
22:49|-|juancgt [~juancgt@c-76-17-127-141.hsd1.ga.comcast.net] has quit [Remote host closed the connection]
22:50<mike>is there a knoppix channel here
22:51<niru>I used d-i preseed/late_command string reboot
22:51<niru>due to this I dont find any syslog file in /var/log/installer/
22:51<velixzeen>mike: http://en.wikibooks.org/wiki/Knowing_Knoppix/Getting_help
22:51<niru>there is no folder called installer in /var/log
22:51<mike>thank you
22:51<niru>after a fresh installation
22:51<niru>why
22:52<velixzeen>search for irc, looks like irc.freenode.net server
22:52<niru>velixzeen, any idea
22:52<niru>any body else
22:52<mike>thnx
22:54<velixzeen>syslog file should be in /var/log
22:54<velixzeen>niru: what are you looking for again?
22:54<mike>theres no one there =/
22:54<mike>wtf
22:55<niru>velixzeen, after a fresh installation the syslog file for instllation report should be in /var/log/installer/syslog
22:55|-|emonge [~emonge@201.247.69.2] has quit [Quit: Saliendo]
22:55<niru>but due to late command it is getting ommited
22:57|-|basjo [~Nokti@tor-irc.dnsbl.oftc.net] has joined #debian
22:59|-|node_3667 [~someone@modemcable073.151-202-24.mc.videotron.ca] has quit [Ping timeout: 480 seconds]
22:59|-|Deselect [~akiva@S0106001195079479.wp.shawcable.net] has left #debian []
23:02|-|deliver [~deliver@dslnet.85-22-17.ip106.dokom.de] has quit [Remote host closed the connection]
23:03|-|manel [~manel@189.134.170.207] has quit [Remote host closed the connection]
23:04|-|leiv [~leiv@124.116.43.124] has joined #debian
23:05|-|lupine [lupine@nick.lupine.me.uk] has joined #debian
23:06|-|lupine_ [lupine@nick.lupine.me.uk] has quit [Read error: Connection reset by peer]
23:07|-|leiv [~leiv@124.116.43.124] has quit []
23:13|-|mike [~Nutz@66.16.30.134] has quit [Quit: Leaving]
23:13|-|kart_ [~kart_@59.182.57.34] has joined #debian
23:14|-|peyman [~peyman@60.50.195.117] has joined #debian
23:19|-|leiv [~leiv@124.116.43.124] has joined #debian
23:19|-|kurumin [~kurumin@200.217.234.23] has joined #debian
23:20|-|kurumin [~kurumin@200.217.234.23] has left #debian []
23:23|-|k-man__ [~jason@ppp121-44-11-242.lns4.syd7.internode.on.net] has joined #debian
23:23|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
23:23|-|GhostlyDeath [~ghostlyde@ool-44c5a585.dyn.optonline.net] has quit [Quit: ReMooD - http://remood.sf.net/]
23:23|-|peyman [~peyman@60.50.195.117] has quit [Ping timeout: 480 seconds]
23:23|-|GhostlyDeath [~ghostlyde@ool-44c5a585.dyn.optonline.net] has joined #debian
23:27|-|basjo [~Nokti@tor-irc.dnsbl.oftc.net] has quit [Quit: Leaving]
23:28|-|k-man_ [~jason@ppp121-44-11-242.lns4.syd7.internode.on.net] has quit [Ping timeout: 480 seconds]
23:31|-|craigevil [~craigevil@96.144.205.68.cfl.res.rr.com] has quit [Remote host closed the connection]
23:31|-|velixzeen [~velixzeen@216.36.141.104] has left #debian []
23:32|-|mjk [~mjk@p54AC586D.dip.t-dialin.net] has joined #debian
23:33|-|kart_ [~kart_@59.182.57.34] has quit [Ping timeout: 480 seconds]
23:37|-|PinBalWyz [~doa@64.184.139.235] has joined #debian
23:38|-|atperez [~atperez@200.77.144.21] has quit [Quit: Ya me voy, ya me despido. Cuídense y hasta pronto.]
23:39|-|Requiem [kc@c-67-161-255-132.hsd1.ut.comcast.net] has joined #debian
23:41|-|qeed [~qeed@adsl-146-70-47.mco.bellsouth.net] has quit [Remote host closed the connection]
23:44|-|varka [~varkatope@p54A5F072.dip.t-dialin.net] has joined #debian
23:44|-|peyman [~peyman@60.51.121.46] has joined #debian
23:45|-|Waddledee [~waddledee@c-24-18-0-114.hsd1.mn.comcast.net] has joined #debian
23:47|-|sebash_ [~sebastian@e176192183.adsl.alicedsl.de] has joined #debian
23:50|-|pato [~pato@189.179.218.246] has joined #debian
23:51|-|kart_ [~kart_@59.182.6.128] has joined #debian
23:52|-|faw [~felipe@faw.user.oftc.net] has quit [Quit: Leaving]
23:52|-|PinBalWyz [~doa@64.184.139.235] has quit [Read error: Connection reset by peer]
23:52|-|toktok7 [~toktok@p57A511EE.dip0.t-ipconnect.de] has joined #debian
23:52|-|kop [~kop@meme-net.meme.com] has quit [Read error: Connection reset by peer]
23:54|-|sebash [~sebastian@e176207048.adsl.alicedsl.de] has quit [Ping timeout: 480 seconds]
23:55|-|toktok6 [~toktok@p57A52586.dip0.t-ipconnect.de] has quit [Ping timeout: 480 seconds]
23:57|-|peyman_ [~peyman@60.51.121.46] has joined #debian
23:59|-|peyman [~peyman@60.51.121.46] has quit [Ping timeout: 480 seconds]
---Logclosed Tue Jul 24 00:00:07 2007