Back to Home / #linode / 2009 / 11 / Prev Day | Next Day
#linode IRC Logs for 2009-11-11

---Logopened Wed Nov 11 00:00:03 2009
00:03<amitz>woah, 20mbps for US$350..
00:04<amitz>ah, with 60GB quota, bummer
00:04<bd_>you do realize that linode gives you 50mbps with a 200GB quota for US$19.95... :)
00:05<bd_>which works out to 3.5TB for US$350/mo
00:05<bd_>(and the 50mbps is of course a liftable soft cap...)
00:06<amitz>bd_: what's missing with linode is the ability to walk down the DC, plug an external storage, and copy all to it.
00:06<bd_>point
00:07<amitz>btw, that's for residential connection.
00:07<bd_>ahhh
00:07<bob2>amitz: I get 18mbit/s on my dsl :)
00:07*amitz slaps bob2, twice!
00:08<amitz>how much do you pay for that?
00:08<bob2>$AU120
00:09<amitz>that is like almost 3 times cheaper!
00:10<bob2>75GB/month
00:11<amitz>heh, anyway I don't think I can afford it even if it's AU120 :-p. 75GB/month is hmm.. reasonable.
00:11<bob2>50GB is a much more reasonable $AU80/month
00:12<amitz>oh, non-linear and it depends on quota!
00:12<bob2>I think theory is that people who are on the higher plans are more likely to use almost all of it
00:13<bob2>whereas people on 50GB are less likely to
00:13<@array>bob2: is the bandwidth split up into off/on peak?
00:13<bob2>array: no
00:13<amitz>I used to think a way to get over the quota. Put a server in a DC, install wifi router on the box, buy a house near the DC, then connect wireless to that server ;-)
00:13<bob2>(internode doesn't do the peak thing on any of their plans)
00:14<@array>bob2: ah nice, internode! I'm currently with a local provider, but I had been looking to switch over internode or westnet
00:14<bob2>internode are excellent
00:15<amitz>here, the server bandwidth cost is not dependent on quota. It depends on guaranteed bandwidth you subscribe to.
00:15<tonyyarusso>amitz: $350 a MONTH?
00:16<amitz>tonyyarusso: yeah. Too far from US :-p.
00:16<tonyyarusso>Note to self: avoid Australia
00:16<bob2>tonyyarusso: that's not au
00:16<tonyyarusso>oh dear, where?
00:16-!-daMaestro [~jon@content.beatport.com] has quit [Ping timeout: 480 seconds]
00:17<amitz>oh yeah, actualy closer to US than AU. Indonesia.
00:17<ajmitch_>and I thought NZ prices were bad...
00:17<tonyyarusso>I think we pay like $40/mo for 7Mbps with a 250GB cap.
00:17<tonyyarusso>For $100/mo we could get 100Mbps
00:18<tonyyarusso>maybe $150, don't remember
00:18<bob2>fibre and cable(tv) are basically undeployed in australia
00:18<amitz>US$48 gives me a (guaranteed in practice) 512kbps unlimited.
00:19-!-techman224 [~techman22@wnpgmb1316w-ds01-226-237.dynamic.mts.net] has quit [Quit: Leaving...]
00:19<@array>internode have plans of rolling out FTTH in selected estates
00:21-!-arthurb_ [~arthurb@office.rbery.bulletproof.net] has quit [Quit: Bye!]
00:23-!-orudie [~Paul@ool-18bded42.dyn.optonline.net] has quit [Read error: Connection reset by peer]
00:24-!-orudie [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
00:25-!-kassah [~kassah@c-71-59-147-2.hsd1.or.comcast.net] has quit [Ping timeout: 480 seconds]
00:25-!-daMaestro [~jon@content.beatport.com] has joined #linode
00:26-!-arthurb [~arthurb@office.rbery.bulletproof.net] has joined #linode
00:29-!-daMaestro [~jon@content.beatport.com] has quit []
00:29-!-blognewb_ [~blognewb@70.134.66.229] has joined #linode
00:31-!-ondrej [~ondrej@24-176-186-44.static.reno.nv.charter.com] has quit [Quit: Leaving]
00:31<Trystan>internode HAVE rolled out ftth to selected estates
00:32<Trystan>and ftth is being rolled out in tas as a test before being rolled out to 98% of Australians
00:32<bob2>(the latter is not by internode)
00:32<Trystan>depends
00:32<Trystan>their current ADSL network is majority not themself either
00:33<Trystan>but they still offer the product
00:33<Trystan>so while its not being done at a network level, they will have a foot in it retail most likely
00:33-!-Guest1576 is now known as meff
00:34-!-meff is now known as Guest1582
00:34-!-HedgeMage [~HedgeMage@c-67-186-107-186.hsd1.il.comcast.net] has quit [Quit: Bedtime!]
00:34<encode>internode are pretty awesome... my parent's place uses them
00:35<Trystan>i use them, gotten a better ping time to US servers through them than any other ISP i have been with so far
00:35-!-blognewb [~blognewb@70.134.66.229] has quit [Ping timeout: 480 seconds]
00:35<encode>i use iinet at home, only because internode didn't have a dslam at the exchange when i moved in
00:36<Trystan>i dont have a choice where i live for a cheaper dslam
00:36<Trystan>so have to use telstra wholesale
00:36<Trystan>but internode's access to TW adsl2+ means i can get it at a decent price atleast
00:37<Trystan>parents use westnet, I keep them on that for if something happens with node and i need net access :D
00:38<Trystan>westnet free pipe used to be awesome :(
00:39<Twayne>!urmom
00:39<linbot>Twayne: Yo momma's so fat, she played hide-and-seek and they kept looking for other kids behind her! (738:0/0) [mormu]
00:47<amitz>.
00:51-!-Keith [fluffy-kit@c-75-70-191-0.hsd1.co.comcast.net] has quit [Quit: Freedom Chat - Your Home Away From Home | http://www.freedomchat.org | tIRC script by the Freedom Chat Leets]
00:54-!-Keith [fluffy-kit@c-75-70-191-0.hsd1.co.comcast.net] has joined #linode
01:01-!-binel [~h00s@93-141-97-85.adsl.net.t-com.hr] has joined #linode
01:01-!-jasonw [~jason@cpe-098-026-111-059.nc.res.rr.com] has left #linode []
01:07-!-RyoKazami [~opera@218.104.158.30] has joined #linode
01:07-!-binel_ [~h00s@93-141-23-196.adsl.net.t-com.hr] has quit [Ping timeout: 480 seconds]
01:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
01:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
01:11-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has quit [Ping timeout: 480 seconds]
01:11-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has joined #linode
01:15-!-MarkJ [~mark@dev.daelhoof.com] has quit [Quit: Lost terminal]
01:15-!-RyoKazami [~opera@218.104.158.30] has left #linode []
01:16-!-arthurb [~arthurb@office.rbery.bulletproof.net] has quit [Quit: Bye!]
01:17-!-atula [~neobreed@c-71-232-0-65.hsd1.ma.comcast.net] has quit [Read error: Connection reset by peer]
01:21<rogi_>Coffee.
01:21<amitz>evil
01:22<rogi_>Even at 6.20am?
01:23-!-RyoKazami [~opera@218.104.158.30] has joined #linode
01:24-!-RyoKazami [~opera@218.104.158.30] has quit [Quit: RyoKazami]
01:24<amitz>evil at some time zones ;-)
01:26<rogi_>Needs to be on the label. Not recommended at certain times, depending on location.
01:27<rogi_>array: Bandwidth for linodes under the same account is pooled (right?), does that apply even if the 'nodes are in different dc's?
01:31<@array>rogi_: sure does, bandwidth is aggregated across all Linodes regardless of what DC they are in
01:32<rogi_>array: aha, ok, thanks. Can I have that in writing. :)
01:32<Trystan>you.. just did :P
01:33<rogi_>Trystan: Good point.
01:33<@mikegrb>lolz
01:33<Trystan>lol :)
01:33*rogi_ goes to get more coffee
01:33<@array>rogi_: sure, open a ticket for an offical support trail :)
01:33<Trystan>but i get what you mean
01:33<Trystan>in a ticket or email :)
01:34-!-Guest1582 is now known as meff
01:35-!-meff is now known as Guest1585
01:37-!-Deckert_za [~Deckert@dsl-240-131-187.telkomadsl.co.za] has joined #linode
01:39-!-Deckert_ [~Deckert@dsl-240-131-187.telkomadsl.co.za] has quit [Read error: Connection reset by peer]
01:42-!-TofuMatt [~TofuMatt@74.198.12.14] has joined #linode
01:42-!-TofuMatt [~TofuMatt@74.198.12.14] has quit []
01:54-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has quit [Ping timeout: 480 seconds]
01:55-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has joined #linode
01:58<@mikegrb>mmm cake
01:58<pbryan>Mmm, coffee. Coffee and cake.
02:05-!-litwol|mac [~litwol@cpe-74-73-167-103.nyc.res.rr.com] has joined #linode
02:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
02:08-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
02:18-!-supine [~marty@dslb-094-219-217-177.pools.arcor-ip.net] has joined #linode
02:24-!-bithaze_ [~nicholas@c-71-206-230-157.hsd1.pa.comcast.net] has quit []
02:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
02:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
02:31-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has quit [Ping timeout: 480 seconds]
02:33-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has joined #linode
02:35-!-jcn [~jcn@207-237-244-88.c3-0.nyw-ubr2.nyr-nyw.ny.cable.rcn.com] has joined #linode
02:35-!-Guest1585 is now known as meff
02:36-!-meff is now known as Guest1589
02:38-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
02:38-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
02:42<SelfishMan>!urmom
02:42<linbot>SelfishMan: Yo momma's so blind, she dated mikegrb and thought it was Ben Affleck! (736:10/0) [ruomm]
02:47-!-jcn [~jcn@207-237-244-88.c3-0.nyw-ubr2.nyr-nyw.ny.cable.rcn.com] has quit [Ping timeout: 480 seconds]
02:47-!-memenode [~daniel@230-129.dsl.iskon.hr] has joined #linode
02:48-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
02:48-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
02:50-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has quit [Ping timeout: 480 seconds]
02:53<litwol|mac>!urmom
02:53<linbot>litwol|mac: Yo momma's so stupid, she managed to MySQL inject an HTML form with no action property. (770:1/5) [omrum]
02:54<litwol|mac>!urmom
02:54<linbot>litwol|mac: Yo momma's so ugly she scared off the crabs in your dad's pants (824:0/3) [rmumo]
02:54<litwol|mac>!urmom
02:54<linbot>litwol|mac: Yo mamma's so fat, even Sir Mix-a-Lot took off running! (798:4/5) [rmuom]
02:54<litwol|mac>!urmom
02:54<linbot>litwol|mac: Yo momma doesn't like people named litwol|mac [uommr]
02:55<litwol|mac>!urmom
02:55<linbot>litwol|mac: Yo momma doesn't like people named litwol|mac [ommru]
02:55<litwol|mac>!urmom
02:55-!-mode/#linode [+q *!*@cpe-74-73-167-103.nyc.res.rr.com] by FloodServ
02:55<linbot>litwol|mac: Yo momma doesn't like people named litwol|mac [rmmou]
02:57<amitz>litwol|mac: we should have paired up. Maybe we can trap linbot into +q ;-)
02:58-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
02:59-!-freireag [~freireag@187.59.201.238] has joined #linode
03:00-!-adnc [~numer@p548558B6.dip.t-dialin.net] has joined #linode
03:01-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has joined #linode
03:08<aspect>359
03:08<amitz>of jumping sheeps. Can't sleep?
03:09-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
03:11-!-blognewb_ [~blognewb@70.134.66.229] has quit [Quit: Client Quit]
03:13-!-adnc [~numer@p548558B6.dip.t-dialin.net] has quit [Ping timeout: 480 seconds]
03:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
03:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
03:20-!-Guspaz [~gus@206-248-152-162.dsl.teksavvy.com] has quit [Read error: Connection reset by peer]
03:24-!-metaperl [HydraIRC@cpe-75-187-105-186.insight.res.rr.com] has quit [Read error: Connection reset by peer]
03:26-!-MarkJ [~mark@dev.daelhoof.com] has joined #linode
03:27-!-Guspaz [~gus@206-248-152-162.dsl.teksavvy.com] has joined #linode
03:27-!-freireag [~freireag@187.59.201.238] has quit [Quit: freireag]
03:32-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has quit [Ping timeout: 480 seconds]
03:33-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has joined #linode
03:33-!-DephNet[Paul] [~Paul@188-220-130-201.zone11.bethere.co.uk] has quit [Quit: Leaving]
03:35-!-Deckert_za [~Deckert@dsl-240-131-187.telkomadsl.co.za] has quit [Read error: Connection reset by peer]
03:36-!-Guest1589 is now known as meff
03:37-!-meff is now known as Guest1595
03:41<Peng>amitz: The urmom bot is smart enough to avoid that.
03:41-!-Deckert [~Deckert@dsl-240-131-187.telkomadsl.co.za] has joined #linode
03:55-!-mode/#linode [-q *!*@cpe-74-73-167-103.nyc.res.rr.com] by FloodServ
04:14-!-ph^ [~ph^@cm-84.211.180.8.getinternet.no] has joined #linode
04:14-!-MI [MonkeyIsla@94.182.75.109] has joined #linode
04:14-!-rogi_ [~rogi@algarveone.robside.net] has left #linode []
04:15-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has quit [Ping timeout: 480 seconds]
04:18-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has quit [Quit: Ex-Chat]
04:20-!-MI [MonkeyIsla@94.182.75.109] has left #linode []
04:25-!-Deckert [~Deckert@dsl-240-131-187.telkomadsl.co.za] has quit [Ping timeout: 480 seconds]
04:27-!-Deckert_ [~Deckert@dsl-240-131-187.telkomadsl.co.za] has joined #linode
04:34-!-rogi__ [~rogi@algarveone.robside.net] has joined #linode
04:37-!-Deckert_ [~Deckert@dsl-240-131-187.telkomadsl.co.za] has quit [Read error: Connection reset by peer]
04:37-!-borkencode [~4c107ef6@webuser.linode.com] has quit [Remote host closed the connection]
04:37-!-Guest1595 is now known as meff
04:38-!-rogi__ [~rogi@algarveone.robside.net] has left #linode []
04:38-!-meff is now known as Guest1605
04:38-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
04:38-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
04:43-!-rogi_ [~rogi@algarveone.robside.net] has joined #linode
04:44-!-sneakums [sneakums@jenny.ondioline.org] has quit [Quit: There shouldn't be this reign of silence, but what are the options when someone great is gone?]
04:45-!-sneakums [sneakums@jenny.ondioline.org] has joined #linode
04:47-!-megatron27 [~firdaus@218.208.36.190] has joined #linode
04:48*amitz sometimes hears transformer's theme song whenever seeing megatron27 has arrived.
04:49<megatron27>amitz, need to force myself to code dude
04:50<amitz>okay, I thought you might need some welcoming distractions. No need to response :-)
04:50<megatron27>so how is life
04:51<megatron27>I wonder, are earthquakes season because you guys have a had a lot recently
04:51<megatron27>seasonal**
04:54<amitz>it's more like one large earthquake might destablized the earth crust of that region, which can only be stabilized by another earthquake, or so I heard.
04:55<megatron27>my theory is that there's an earthquake each time Inul dances :D
04:55<amitz>or by many smaller earthquakes. Because another large earthquake might make the adjustment to extreme that you need another earthquake.
04:55<amitz>she is fat now, and rich ;-)
04:56<megatron27>explains it
04:57<amitz>She invest her income wisely after she got rich with her drilling move. Now she doesnt have to drill anymore thus not burning much fat thus fatter :-p
04:57<@mikegrb>roflz
04:57<megatron27>rofl
04:57<megatron27>but come on, what kind of man is turned on by an old lady gyrating like that
04:57<amitz>do you follow her enough about her conflict with the founder of dangdut?
04:57<megatron27>nope
04:58<megatron27>I hate dangdut
04:58<amitz>well, I must say she gyrates well. Not the best it seems but well enough ;-)
04:58<amitz>with good enough body to boot.
04:58<megatron27>ewww
04:59<megatron27>Julia Estelle is way better
04:59<megatron27>what's the name of her song
04:59<amitz>uh, Julia Estelle has no body. She is flat like a board.
04:59<megatron27>there's more to a woman that how she looks you shallow chauvinist pig!
04:59<amitz>dude, I really want to continue this but wife is calling, gtg.
05:00<megatron27>see you
05:03<chesty>shuffle up and deal
05:04-!-hpj [~hpj@40.89-10-30.nextgentel.com] has joined #linode
05:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
05:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
05:19-!-DephNet[Paul] [~Paul@188-220-130-201.zone11.bethere.co.uk] has joined #linode
05:20<bryen>how do I get the linode dns manager to activate a zone?
05:20-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has joined #linode
05:21<chesty>did you wait 15 minutes?
05:21<bryen>I believe so, it was set up as disabled. But now I want to activate it.
05:21<bryen>I just don't see the option to change that.
05:21<chesty>oh, no idea
05:22<bryen>just found it. it was buried :-)
05:38-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
05:38-!-Guest1605 is now known as meff
05:38-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
05:39-!-meff is now known as Guest1610
05:39-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
05:39-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
05:46-!-azaghal [~azaghal@91.148.113.100] has quit [Ping timeout: 480 seconds]
05:48-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
05:48-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
05:50-!-azaghal [~azaghal@91.148.113.100] has joined #linode
05:58-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
05:58-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
06:06<bryen>Sure would be nice if the Linode DNS Manager included a drop-down menu for initial setup to give us a chance to indicate which node we want the domain to point to. I always forget and have to go back in and change the IP address (something I also never seem to memorize)
06:06<bob2>it does
06:06<bob2>well
06:07<bob2>I guess it should show the linode name in brackets after each IP
06:07<rainman_>so
06:07<rainman_>the problem is that you don't seem to remember IP addresses
06:07-!-internat [~nf@123-243-184-161.static.tpgi.com.au] has quit []
06:08<bryen>I believe I mentioned that :-)
06:08<bryen>bob2: Yeah, that's what I'm referring to.
06:10-!-internat [~nf@123-243-184-161.static.tpgi.com.au] has joined #linode
06:11-!-Kuukunen [~ajantti@duf4.kyla.fi] has quit [Ping timeout: 480 seconds]
06:11-!-jengdal [joen@infa.abo.fi] has quit [Ping timeout: 480 seconds]
06:15-!-Kuukunen [~ajantti@duf4.kyla.fi] has joined #linode
06:16-!-jengdal [joen@infa.abo.fi] has joined #linode
06:21<linbot>New news from forums: Domain not working without 'www' infront of name in Linux Networking <http://www.linode.com/forums/viewtopic.php?t=4824>
06:34-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has quit [Quit: Ex-Chat]
06:39-!-Guest1610 is now known as meff
06:40-!-meff is now known as Guest1614
06:44-!-Tallken [~f2f93bf57@93.102.92.102.rev.optimus.pt] has quit [Quit: Leaving]
06:46-!-ph^ [~ph^@cm-84.211.180.8.getinternet.no] has quit [Remote host closed the connection]
06:49-!-Deckert [~Deckert@dsl-240-131-187.telkomadsl.co.za] has joined #linode
06:51-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
06:51<linbot>New news from forums: When to run more linodes for one site? in Performance and Tuning <http://www.linode.com/forums/viewtopic.php?t=4825>
06:52-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Read error: Connection reset by peer]
06:55-!-Deckert [~Deckert@dsl-240-131-187.telkomadsl.co.za] has quit [Read error: Connection reset by peer]
06:58-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
06:58-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
07:03-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
07:03-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
07:15-!-atambo [~atambo@ATAMB0.RES.CMU.EDU] has quit [Read error: Connection reset by peer]
07:21<Yaakov>RACE CONDITION
07:21<chesty>.
07:21*Peng races Yaakov
07:25-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
07:25-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
07:32<bryen>okay, so... any DNS experts here? I've set up a new domain but the browser is pointing it in all the wrong places, although pinging it resolves to the proper IP address. It's been over an hour since I set up the domain.
07:33<bryen>if I enter http://domainname.com, it points to the wrong node, and if I enter http://www.domainname.com it points to the "construction page" offered by Network Solutions
07:33<bob2>mention the actual name
07:33<bryen>fetesnyc.com
07:34<rainman_>bryen, your browser may well have a dns cache too
07:34<KingTarquin>bryen, Are you using your ISP's default DNS settings? If so, it could take a while. (Some ISP's don't propagate as quick as others).
07:34<rainman_>KingTarquin, from the same machine, ping resolves it ok, so it can't be the ISP resolver
07:34<bryen>rainman_: I opened up another browser (opera) that hadn't ever gone to fetesnyc.com and it had the same problems
07:34<KingTarquin>Touche
07:34<rainman_>interesting
07:34*KingTarquin goes back to idling.
07:35<rainman_>KingTarquin, nofi :)
07:35<DephNet[Paul]>bryen, domain?
07:35<bob2>fetesnyc.com
07:35<DephNet[Paul]>!dns fetesnyc.com
07:35<linbot>DephNet[Paul]: 97.107.135.216
07:35<bob2>if it is windows, reboot
07:35<bob2>it sure resolves ok
07:36-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has joined #linode
07:36<sefz>hi everybody
07:36<@irgeek>Yup. That looks like a local cache issue.
07:36<KingTarquin>bob2, No need to reboot, just ipconfig /flushdns
07:36<bryen>but the browser is pointing to 97.107.132.192
07:36<sefz>i want to know something about linode
07:36<DephNet[Paul]>i get "comming soon" on both www and fetesnyc.com
07:37<@irgeek>!ask
07:37<linbot>Don't ask to ask; just ASK
07:37-!-xrfang [~chatzilla@218.79.37.235] has joined #linode
07:37<bob2>bryen: you didn't hack your hosts file or something did you?
07:37-!-jtaji [~jtaji@c-174-59-115-229.hsd1.pa.comcast.net] has quit [Quit: Leaving]
07:37<bryen>DephNet[Paul]: Really? Interesting, you got it correctly then
07:37<bryen>bob2: nope
07:37<bob2>bryen: ditto
07:37-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
07:38<bryen>then it's just me :-) That's not a terribly bad thing
07:38<sefz>what plan is best suitable for my needs? (wordpress blog with 25k uniques/day, with several peaks during evening (500 users simultanous connections) ?
07:38-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Read error: Connection reset by peer]
07:39<amitz>so many wordpress users, must take a look some time..
07:40<@irgeek>sefz: Too many variables to give you an answer, really. You can start low - upgrading is easy.
07:40*bryen wants to be friends with sefz and figure out how he gets that much traffic on his blog (or her blog)
07:40<@irgeek>bryen: Try porn.
07:40-!-Guest1614 is now known as meff
07:40<bryen>irgeek: I try it all the time. :-)
07:41-!-meff is now known as Guest1623
07:41<amitz>bryen: try the more universal porn
07:41*bryen is afraid to ask
07:41<sefz>bryen, it's a movie streaming website
07:42<HoopyCat>bryen: the ttl on fetesnyc.com as it stands now (pointing, for me using opendns, at 97.107.135.216) is at 1 day, so allow ~24 hours or so for the old IP to disappear
07:42<@irgeek>sefz: Are we going to get DMCA complaints?
07:43<sefz>no, i hope:)
07:43<bryen>HoopyCat: Should I change my TTL? or leave it at the default (which I guess is 1 day)
07:43<sefz>are you in the linode staff?
07:43<@irgeek>!ops
07:43<linbot>Users with ops are employees of Linode, and know what they're talking about. The rest of us are the ever-so-helpful(?) community.
07:44<bob2>bryen: too late
07:44<bob2>bryen: everyone has cached the ttl too
07:44<sefz>:) so i have another question: is technical support available to Linode customers? I mean, if for example, i want to setup Nginx instead of Apache, I have to do it alone?
07:45<bryen>bob2: Okay. Interesting though as I've never had this problem in the past and I've got about 10 domains set up so far.
07:45<bob2>sefz: you get a linux vps, doing anything inside it is your issue
07:45<bob2>sefz: that saidm library.linode.com has lots of useful docs
07:46<sefz>it's possible to have paid technical support? for m
07:46<@irgeek>We don't provide it, but you can always hire someone.
07:47-!-KingTarquin [~Tarquin@82-43-240-117.cable.ubr03.pres.blueyonder.co.uk] has quit [Remote host closed the connection]
07:47<bryen>sefz: Getting paid technical support inside your vps is pretty much the same as technical support for a real physical server. You hire the consultant that best fits your needs.
07:48<bryen>Since vps owners can pretty much do whatever they want under the sun (legally of course), it would be impossible for Linode to provide that level of support across the board.
07:48<A-KO>yep
07:48<HoopyCat>bryen: you probably didn't put the wrong IP in there at first for the other 10 domains :-) if you control your local DNS server or are using something like opendns, you can clear its cache; otherwise, hope someone trips over its power cord soon.
07:48<A-KO>bryen: tell that to my company, who hired a dba to support 2 lamp boxes :P
07:49<A-KO>because "oh he's a DBA with Oracle stuff--he must know linux"
07:49<sefz>is there anyone available for hire to do a nginx setup/optimization on a vps box? (enabling rewrites for wp-supercache)
07:49<bryen>A-KO: Name and phone number to call please?
07:49<amitz>A-KO: is the origin of your nick is "Project A-KO"?
07:49<A-KO>yes amitz :P
07:49-!-KingTarquin [~Tarquin@82-43-240-117.cable.ubr03.pres.blueyonder.co.uk] has joined #linode
07:49<@mikegrb>lolz
07:49<A-KO>lol bryen
07:50<bryen>well HoopyCat The problem for me whenever I set up a domain is that it always defaults to my first node and then I have to go back in and manually change it. I wish Linode DNS Manager gave me an option to point to the correct node as soon as I create a zone.
07:50<A-KO>it takes 15 minutes for linode's dns servers to refresh
07:50<A-KO>or w/e :P
07:50<A-KO>you have a little window of time to change it by hand
07:51<bryen>which I did, but somehow it didn't happen right this time. I guess when I set it upt it was just at the end of the systematic 15-minute period for Linode :-)
07:51<A-KO>eh, it's dns, it'll update eventually
07:51<A-KO>set low TTL values, most DNS servers should handle those properly
07:52<HoopyCat>bryen: you could duplicate an existing zone (or start blank), but at least when i add a master here, it's giving me a choice of IPs to template from...
07:52<amitz>bryen: there is a(n) alpha/beta version of DNS setting where you can just dump the DNS "definition". Just wait.
07:52<A-KO>only set long TTLs when you know DNS isn't going to change
07:53<bryen>does ttl only affect a records? Because ping has always resolved correctly.
07:53<A-KO>if it's resolving what's the problem?
07:54<bryen>A-KO: browser is resolving to the wrong places
07:54<A-KO>stop and restart dns client service in Windows?
07:54<@irgeek>bryen: When you add the zone there's a pull-down to select the IP you want the records to resolve to.
07:55<HoopyCat>bryen: hmm... is the browser resolving it incorrectly, or is there some cache in between that's resolving it wrong?
07:55<HoopyCat>bryen: (HTTP cache, not DNS cache)
07:56<bryen>irgeek: not on my end. I don't see any such pulldown.
07:56<@irgeek>You could also cook your own that works however you like - https://www.linode.com/api/
07:56<@irgeek>bryen: How are you creating the zone?
07:56<A-KO>HoopyCat: if it's windows, stopping and restarting the dns client service often works, I've had to do that a few times to get things to work properly (since I vpn to my linode, sometimes the DNS servers it tries to get are wrong, occasionally)
07:57<A-KO>no idea why :P nslookup works fine,but browsing doesn't, etc.
07:57<@irgeek>It doesn't use the same library calls.
07:58<bryen>irgeek: Go to DNS Manager and "add a zone"
07:58<HoopyCat>bryen: i get http://hoopycat.com/~rtucker/tmp/linode-dns-manager-add-master-zone.png after i type "blarfle.com" and select Master on the "add a new domain zone" screen
07:58<@irgeek>bryen: Look at the third image: http://library.linode.com/linode-manager/configuring-dns-with-the-linode-manager.html
07:59<HoopyCat>err, blarfle.local
07:59<A-KO>:P .local, win :P
08:00<bryen>irgeek: ohhhh I see that now...
08:00<@irgeek>;)
08:00<bryen>Sorry, Seriously, I am visually impaired and that was a little outside of my range of vision. Didn't realize there was something in that spot.
08:01<bryen>irgeek: Although I think you should include node names in that dropdown.
08:02-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
08:03-!-ubuntuisloved [~jason@cpe-74-67-36-120.nycap.res.rr.com] has quit [Ping timeout: 480 seconds]
08:03-!-orudie [~Paul@ool-18bded42.dyn.optonline.net] has quit [Read error: Connection reset by peer]
08:12-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has joined #linode
08:12<@irgeek>bryen: IP addresses can be configured for failover. Showing the name of the Linode doesn't make much sense there.
08:14-!-cpg [~cpg@c-76-126-208-117.hsd1.ca.comcast.net] has quit [Quit: cpg]
08:14<bryen>if you're configured for failover :-)
08:16-!-walterheck [~walterhec@124.157.181.121] has joined #linode
08:18-!-cdlu [~cdlu@cdlu.ombudsman.oftc.net] has joined #linode
08:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
08:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
08:19-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
08:20-!-gmcharlt [~gmcharlt@75-150-13-105-Atlanta.hfc.comcastbusiness.net] has joined #linode
08:21-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
08:25-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
08:27-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
08:34-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has joined #linode
08:38-!-new_user [~4df2dccf@webuser.linode.com] has joined #linode
08:38<new_user>hi
08:38<new_user>i need help
08:40<Yaakov>new_user: Hello.
08:40<Yaakov>new_user: You can ask your question, if someone can help, they will.
08:40<Yaakov>People with @ are staff, the rest of us are Linode customer-fans.
08:41<new_user>with a lin node i can make hosting?
08:41<Yaakov>new_user: A Linode is the functional equivalent of a Linux server. It acts is almost every way precisely as any Linux server acts.
08:41-!-Guest1623 is now known as meff
08:42<new_user>there are restriction?
08:42<Yaakov>new_user: You can use it for anything you would use a Linux server to do.
08:42-!-Guspaz [~gus@206-248-152-162.dsl.teksavvy.com] has quit [Read error: Connection reset by peer]
08:42<Yaakov>new_user: The only restrictions are legal and ethical.
08:42-!-meff is now known as Guest1632
08:42<new_user>i can ru an email server for multo host?
08:42<Yaakov>new_user: You can't become a problem for Linode or your "neighbors" who share the machine.
08:42<HoopyCat>new_user: the terms of service details the restrictions, but it boils down to "if it's legal and doesn't negatively impact others, it's generally OK"
08:42<Yaakov>new_user: Except for spam, any email is just fine.
08:43<new_user>ok
08:43<new_user>the are a flat formula for traffic?
08:43<@irgeek>Flat formula?
08:43-!-linville [~linville@sapphire.tuxdriver.com] has joined #linode
08:44-!-bbeausej [~bbeausej@mirage.turbulent.ca] has joined #linode
08:44<new_user>for the traffic
08:44<HoopyCat>new_user: http://www.linode.com/tos.cfm is the terms of service
08:45<@irgeek>new_user: We don't understand your question.
08:45<@irgeek>What do you mean by "flat formula"
08:45<HoopyCat>new_user: a flat formula as in "a given amount of data per month", as opposed to "95% percentile" or something like that?
08:45<Yaakov>new_user: There is a *protective* cap on outbound traffic which can be lifted at your request. It is generally not noticeable though.
08:46<new_user>ok i understand
08:46<rainman_>there's a limit in GBs though
08:46-!-ubuntuisloved [~jason@fw.sgstestcom.com] has joined #linode
08:46<Yaakov>new_user: Other than that, you get the transfer in your plan, and can pay for more.
08:46<rainman_>and if you go over, you pay extra
08:47<Yaakov>If you can fill the pipe, I will be impressed.
08:54-!-TheJoe|ZzZz is now known as TheJoe
08:57-!-orudie [~paul@ool-4b7f8ec4.static.optonline.net] has joined #linode
08:58<HoopyCat>today's a bank holiday in the US, innit?
09:00<xrfang>I have some problem with ssh, it often got freeze, sometime I guess it is because of long period of inactivity, but then it should just disconnect me instead of get frozen.
09:00<xrfang>any ideas please
09:00<xrfang>btw, network seems ok, as I can visit the http server with browser
09:03-!-metaperl [HydraIRC@cpe-75-187-105-186.insight.res.rr.com] has joined #linode
09:04<palintheus>HoopyCat: yes, Veterans day
09:06<linbot>New news from forums: Reboot: dallas182 in System and Network Status <http://www.linode.com/forums/viewtopic.php?t=4826>
09:07<Peng>Mail holiday, too.
09:08-!-megatron27 [~firdaus@218.208.36.190] has quit [Quit: Ex-Chat]
09:08<@irgeek>Ah crap. I had stuff to mail today.
09:10-!-gmcharlt [~gmcharlt@75-150-13-105-Atlanta.hfc.comcastbusiness.net] has quit [Quit: Leaving]
09:13-!-bryen [~bryen@c-24-12-18-1.hsd1.il.comcast.net] has quit [Remote host closed the connection]
09:14<HoopyCat>xrfang: does keeping something fairly active going in the ssh window (e.g. "vmstat 1") hold it up longer than it otherwise would? what sort of stuff is between your ssh client and the internet (NAT routers, firewalls, etc)?
09:15<xrfang>HoopyCat: I am using a home adsl with a router, I don't think there are any firewall, also, this happened today earlier in my office too
09:15<xrfang>the symptom is that ssh client (in gnome terminal) freezes
09:15<xrfang>and ping also does not reply, just the web is ok
09:16<xrfang>this some time gets recovered automatically, but just before I posted the question, 2 ssh window freezed completely,
09:16<xrfang>after I close the window and reconnect, the connection is ok...
09:16<@irgeek>Did they freeze at the same time?
09:16<xrfang>I wonder if the server is encountering high disk i/o load??
09:16<fapestniegd>Tauntaun now on preorder! + new stuff at ThinkGeek
09:16<xrfang>I guess so, but I am not sure, I went away doing other things,
09:17<@irgeek>And was this from a laptop you're taking with you. In other words are the connections from the same computer every time?
09:17<xrfang>if you mean home and office, they are 2 PCs
09:17<HoopyCat>xrfang: stateful firewalls will drop all knowledge of a flow after some amount of time, and if it's doing NAT, that would drop the mapping. generally speaking, disk I/O should have little to do with it (although that can be verified easily enough with "vmstat 1" as well :-)
09:18<xrfang>when it happened in office earlier today, it recovers quickly
09:18<xrfang>I am not sure... just will monitor this... I am now doing some testing with nginx on my local pc, so will keep an ssh client connected in background see what happens...
09:19<xrfang>thanks for your help... if this happens again I will return and ask.
09:20<HoopyCat>i generally ensure the server end has "TCPKeepAlive yes" in sshd_config and that usually does it, although my routine ssh traffic is tunneled over openvpn (which transports via udp and has its own keepalive behavior) so i haven't gone beyond that
09:20*HoopyCat fires up an ssh through not-the-vpn to see how that goes, then wanders off to make a sandwich
09:22<getsmart>I have a linode at dallas, where are others avails?
09:22<@irgeek>!avail
09:22<linbot>irgeek: Linode360 - 141, Linode540 - 102, Linode720 - 59, Linode1080 - 43, Linode1440 - 32, Linode2880 - 3
09:23<@irgeek>getsmart: http://www.linode.com/avail.cfm
09:23<getsmart>uhm, where? any other place != dallas?
09:23<@irgeek>Click it! :)
09:23<getsmart>with different connectivity I hope
09:23<getsmart>let's see
09:23<getsmart>oh thanks
09:24<JshWright>!avail-planet
09:24-!-Holstein [~BenC@mirage.turbulent.ca] has joined #linode
09:24<JshWright>!avail-dallas
09:24<linbot>JshWright: Dallas360 - 44, Dallas540 - 34, Dallas720 - 20, Dallas1080 - 8, Dallas1440 - 5, Dallas2880 - 1, Dallas5760 - 1, Dallas8640 - 1, Dallas11520 - 1, Dallas14400 - 1
09:24<@irgeek>!avail-tp
09:24<getsmart>I see
09:24<linbot>irgeek: Dallas360 - 44, Dallas540 - 34, Dallas720 - 20, Dallas1080 - 8, Dallas1440 - 5, Dallas2880 - 1, Dallas5760 - 1, Dallas8640 - 1, Dallas11520 - 1, Dallas14400 - 1
09:25<Nivex>!avail
09:25<linbot>Nivex: Linode360 - 141, Linode540 - 102, Linode720 - 59, Linode1080 - 43, Linode1440 - 32, Linode2880 - 3
09:28-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
09:31-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has quit [Read error: Connection reset by peer]
09:31-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
09:38<cmjb>whats the standard way to configure a second static IP on a linode thats on a different subnet / has a different gateway from the primary interface IP ?
09:39<orudie>is it illegal in the U.S. to have more than 1024 bit security key ?
09:39<HoopyCat>cmjb: just pick one gateway; both IPs are on the same physical subnet, so both gateways are equally valid.
09:39<amitz>orudie: shouldn't be.
09:40<HoopyCat>orudie: i don't believe so (to the point that i use keys longer than that)
09:40<rainman_>just specifying on bits is useless
09:40<amitz>rainman_: exactly
09:41<rainman_>the US used to be extremely strict in exporting encryption though
09:41<HoopyCat>orudie: there are restrictions on export, but i don't believe there are restrictions on use or development.
09:41<orudie>export ?
09:41<rainman_>yes
09:41<orudie>i don't get it
09:41<orudie>export of what
09:41<rainman_>code and algorithms
09:41<HoopyCat>orudie: export of encryption technology
09:42<rainman_>if microsoft builds superstrong encryption in IE, they can not ship that to iran
09:42<rainman_>though they might already not be allowed to
09:42<rainman_>there used to be a special export version of IE that only did 40-bit SSL
09:42<rainman_>and even europe could only have that one
09:42-!-Guest1632 is now known as meff
09:43<HoopyCat>http://www.bis.doc.gov/encryption/pubavailencsourcecodenofify.html is most applicable to most of the stuff i deal with
09:43<@irgeek>orudie: Encryption is classified as "munitions" so they have the same export restrictions.
09:43-!-meff is now known as Guest1640
09:43<Nivex>munitions. That always makes me chuckle. "Imma blow your head off with this 1024-bit AES cipher!"
09:44<@irgeek>cmjb: http://library.linode.com/networking/configuring-static-ip-interfaces
09:44<HoopyCat>Nivex: it's funny now, but the cold war was a strange, strange time
09:44-!-iicsa [~rpender@rchp4.rochester.ibm.com] has joined #linode
09:45<JshWright>Nivex: print it out in binary on cardstock and you might be able to bludgeon someone with it
09:45<Nivex>HoopyCat: Now isn't really much different. Just s/Red/Terrorist/ on all the news releases, sit back, and watch the fireworks.
09:46-!-walterheck [~walterhec@124.157.181.121] has quit [Read error: Connection reset by peer]
09:46<amitz>rainman_: and debian used to a repository for countries who can't import those tech.
09:47<rainman_>yes
09:47<HoopyCat>Nivex: yup, although the threat of terrorism to the average person is a fart in the wind compared to GLOBAL THERMONUCLEAR WAR
09:47-!-walterheck [~walterhec@124.157.181.121] has joined #linode
09:47<amitz>woah, damn,now I wonder how the hell do I know that...
09:47<rainman_>i think we've mostly gone to "you may have to go to jail, if you do not give the password of the encrypted disk of which we reasonably suspect it exists, and reasonably suspect you know the password"
09:48<HoopyCat>amitz: because you're outside the US and had to know that, because the US-based repos couldn't store software you needed :-)
09:48<amitz>HoopyCat: suppose to be that, but I thought my first encounter with debian was sarge (3.0) and I don't think they have that kind of separation...
09:49<HoopyCat>rainman_: yup, which is closer to where it probably needs to be, but it's still a constitutional quagmire.
09:49<amitz>oh wait, sarge is 3.1
09:49<HoopyCat>amitz: might be patent-related issues too
09:50<amitz>HoopyCat: hmm yeah, probably. I have some slight recalling of something along that line.
09:52-!-Hareem-Haque [~chatzilla@bas1-toronto29-1279397658.dsl.bell.ca] has joined #linode
09:52<Hareem-Haque>hello everyone how are you doing.
09:52<amitz>yo
09:53-!-jcr [~463043ed@webuser.linode.com] has joined #linode
09:55<adj>we be jammin
09:55<Hareem-Haque>Got a quick question.. I wish to purchase 5 - 10 linodes and would like to set them up in a way so that i could queue up jobs onto them. I will be using ffmpeg & imagemagick.. I would like to know which application is the easiest to setup a job queue etc..
09:57<@irgeek>http://aws.amazon.com/sqs/
09:57<Hareem-Haque>how exactly to use it.?.. sorry im not a super duper pro programmer
09:59<@irgeek>It's a queue. You write something that sticks jobs into the queue and you write something else that checks for things in the queue and processes them.
09:59<Hareem-Haque>ok. Thank irgeek. Any other suggestions
10:01-!-RSully [~RSully@ip72-192-15-149.ri.ri.cox.net] has joined #linode
10:01<HoopyCat>writing some sort of thing that collects jobs into a queue and then, when other things check for something in the queue, dispense one
10:02<HoopyCat>(which is probably how i'd do it, since i've never done it before and find it difficult to appreciate the cost of wheels without spending weeks in the garage with a geometry text and a band saw)
10:02<@irgeek>http://memcachedb.org/memcacheq/
10:03<Hareem-Haque>How would memcache work... don't i need a queue manager
10:04<@irgeek>Did you even look at that page?
10:04<@irgeek>"MemcacheQ - Simple Queue Service over Memcache"
10:05<Hareem-Haque>sorry didn't mean it that way.. I am looking at this.. looks a fair bit ok to me. Will attempt to use this.
10:05-!-jcr [~463043ed@webuser.linode.com] has quit [Remote host closed the connection]
10:08<amitz>by any chance, anybody know the AT command to disconnect an EVDO modem?
10:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
10:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
10:08<amitz>SpaceHobo: doesn't work.
10:09<iicsa>postfix q: i have some entries in my mail.info log that are failing to deliver mail because of a unresolvable host. It seems like it keeps trying to deliver it. How do I control how long undeliverable messages are retried? anyone know?
10:10<iicsa>i've been searching man page, and only thing that looks close to what im lookign for is bounce_queue_lifetime
10:10<iicsa>not quite sure what bounce_queue_lifetime does from the short desc in the manpage.
10:11<amitz>another method. How to cut power supply to a USB port using linux?
10:12-!-Redgore [~redgore@94-194-111-182.zone8.bethere.co.uk] has joined #linode
10:14<adj>SpaceHobo: you need a better method...
10:15<adj>it was never that reliable though. most modems wouldnt see it as command string
10:15<adj>ping -p "2b2b2b415448300d" <-- that always worked better for me
10:16<adj>and it will still cause any webtv boxes to disc
10:16<adj>and probably anyone connecting from an older modem
10:17-!-bbeausej [~bbeausej@mirage.turbulent.ca] has quit [Read error: Connection reset by peer]
10:17-!-bbeausej [~bbeausej@mirage.turbulent.ca] has joined #linode
10:23-!-iicsa [~rpender@rchp4.rochester.ibm.com] has quit [Quit: Ex-Chat]
10:26-!-nard [~nard@CPE001ff33e804d-CM00159a68e808.cpe.net.cable.rogers.com] has quit [Quit: nard]
10:28-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
10:28-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
10:32<RSully>Sup guys
10:34<Bdragon>No thanks I just ate
10:34<RSully>Bdragon: You just recently get a linode? Not used to seeing you around
10:36-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has quit [Quit: Ex-Chat]
10:37<Bdragon>No, I've had a linode since august 2005
10:37<RSully>Ohh
10:37<RSully>I've been here for a month or two noaw
10:38-!-bbeausej_ [~bbeausej@mirage.turbulent.ca] has joined #linode
10:38-!-bbeausej [~bbeausej@mirage.turbulent.ca] has quit [Read error: Connection reset by peer]
10:40<Pryon>Bdragon: I'm glad I'm not the only one tempted to respond in that fashion
10:40*irgeek has Linode #9 :p
10:40<@irgeek>So there!
10:40<RSully>Whut datacenter
10:41<@irgeek>The one over there ---->
10:42-!-RSully [~RSully@ip72-192-15-149.ri.ri.cox.net] has quit [Remote host closed the connection]
10:42-!-awnstudio [~awnstudio@c-69-249-126-215.hsd1.pa.comcast.net] has joined #linode
10:43-!-Guest1640 is now known as meff
10:44-!-meff is now known as Guest1650
10:45-!-xrfang [~chatzilla@218.79.37.235] has quit [Quit: ChatZilla 0.9.85 [Firefox 3.5.4/20091028153816]]
10:51<randallman>heh just reading the logs - I generate 10GB of logs per week from our blackhole MX server... It just delivers anything it receives to the DISCARD mailer :P
10:52<randallman>runs a constant 200 smtp connections 24/7 :p
10:52<randallman>Looks like an open relay :P
10:52-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
10:52<randallman>Wonder if there is any value to the mail
10:52-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
10:52<randallman>Guspaz, you around?
10:53-!-cho [~cho@208.86.120.227] has joined #linode
10:54<cho>Can/should I run NTP clients on my Linodes? Is it redundant with time sync provided by the hosts? Would it work against the time sync by the hosts?
10:54<@caker>cho: if running 2.6.18 ntp isn't needed. If running paravirt (something newer than 2.6.18) yes, you need to run ntp
10:56<cho>ty
10:57<path>randallman: i wonder if you could analyze it in some way to find spam and build an RBL
10:57<cho>Does Linode have any local NTP servers I could sync to?
10:57<path>i have one on the private network on newark
10:58<path>i also use the ntp.org pool servers
10:58-!-xrfang [~chatzilla@218.79.37.235] has joined #linode
10:58-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
10:58<path>192.168.133.10 is my newark ip
10:58<randallman>path :P
10:58<randallman>Perhaps :P
10:59<cho>ty path
10:59<path>maybe you could sell it and generate another revenue stream ;)
10:59<randallman>Path, SpamAssassin's bayes stuff would choke like a mofo :P
10:59<path>useless mail.. $20/gig
10:59<rHn_>does Linode accept Visa debit cards?
10:59<cho>perhaps all the useless emails could be used as packing material
11:00<randallman>cho, NICE!
11:00<path>:)
11:00<cho>Just so the bits don't go to waste
11:01<randallman>Heh, the box runs its own NAMED process too
11:01-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
11:01<randallman>since it's constantly doing DNS lookups
11:02<path>i always run named on servers now
11:02<path>if just for caching
11:02<randallman>we just fixed all of our in-addr's and then also fixed out caching nameds
11:02<randallman>they were setup to poll AD every night for all the zones for which AD was auth-internally
11:02<randallman>and setup forward-only lines in the named.conf
11:02<randallman>it was terrible
11:02-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
11:02-!-daMaestro [~jon@content.beatport.com] has joined #linode
11:02<randallman>and it added additional and auth RR's pointing to the roots
11:02<randallman>even on internal responses that were authoritative
11:03<randallman>so we're just slaving those from AD now :)
11:03<path>we slave AD off of named
11:03<randallman>but still generating the list of 'to be slaved' via ldap query of ForestDnsZones.
11:03<randallman>Anyway, meeting :)
11:03<path>later
11:03-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
11:05-!-Deckert [~Deckert@dsl-240-131-187.telkomadsl.co.za] has joined #linode
11:06-!-elfgoh [~dingding@adsl252.dyn212.pacific.net.sg] has joined #linode
11:17-!-cho [~cho@208.86.120.227] has quit [Quit: cho]
11:19-!-walterheck [~walterhec@124.157.181.121] has quit [Ping timeout: 480 seconds]
11:20-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has quit [Ping timeout: 480 seconds]
11:32<randallman>Yay for useless meetings!
11:33<amitz>without meeting, your company won't be as big as it is now, head count wise.
11:38-!-orudie [~paul@ool-4b7f8ec4.static.optonline.net] has quit [Quit: Leaving]
11:39<randallman>no doubt ;)
11:40<litwol|mac>!urmom ?
11:40<linbot>litwol|mac: HTTP Error 500: Internal Server Error
11:40<litwol|mac>!urmom
11:40<linbot>litwol|mac: Yo momma's so smelly, New Jersey left HER! (741:2/0) [umomr]
11:40-!-xrfang [~chatzilla@218.79.37.235] has quit [Quit: ChatZilla 0.9.85 [Firefox 3.5.4/20091028153816]]
11:40<litwol|mac>yey no more +q
11:40<litwol|mac>amitz: so... up for it? 02:57 amitz: litwol|mac: we should have paired up. Maybe we can trap linbot into +q ;-)
11:40<randallman>Hmm
11:40<randallman>I hate 2 byte unicode :)
11:40<randallman>things like sed and awk not work so gewd.
11:41<litwol|mac>patch awk and sed ?
11:41<Bdragon>pipe it through iconv?
11:41<litwol|mac>make them work gewd
11:41-!-jcn [~jcn@rrcs-208-105-67-138.nyc.biz.rr.com] has joined #linode
11:41<randallman>all characters needed for life can be expressed in 7 bits ;)
11:41<randallman><< redneck :P
11:42<randallman>Hmm iconv didn't like the <ff><fe> at the beginning
11:42<randallman>vi -b'd it and it works now
11:43<adj>gotta kill the bom ;)
11:43<Bdragon>BOM is for silly people.
11:43-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
11:43<Bdragon>in utf8 at least
11:43<randallman>actaully none of that crap worked :)
11:43<randallman>it was all still CHAR^@CHAR2^@
11:43<randallman>etc.. :P
11:43-!-A-KO [as@c-69-143-90-155.hsd1.md.comcast.net] has quit [Read error: Connection reset by peer]
11:44-!-A-KO [as@c-69-143-90-155.hsd1.md.comcast.net] has joined #linode
11:44-!-hammockhero [~hammockhe@180.72.38.26] has quit [Quit: hammockhero]
11:44-!-Guest1650 is now known as meff
11:44-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Read error: Connection reset by peer]
11:45-!-meff is now known as Guest1660
11:47<adj>i only use utf64
11:47<adj>utf8 is for the weak
11:47<adj>i can't fully express myself without it
11:50-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
11:52-!-elhippo [~elhippo@cpe-70-112-188-172.austin.res.rr.com] has joined #linode
11:52-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
11:52-!-kenichi [~kenichi@199.223.126.66] has joined #linode
11:55-!-Ghent [~ghent@nin.tarminc.com] has quit [Quit: leaving]
11:57-!-Ghent [~ghent@nin.tarminc.com] has joined #linode
11:57-!-gsf [gsf@manheim.library.drexel.edu] has left #linode []
11:58-!-gary4gar [~gaurish@59.95.190.254] has joined #linode
11:58<gary4gar>Hi all
12:00-!-kenichi [~kenichi@199.223.126.66] has left #linode []
12:01<adj>yo
12:05-!-ShaunR [~Shaun@staff.ndchost.com] has joined #linode
12:06<gary4gar>I have a problem with apache virtual host configration. Its a new centos server, I added new vhost as NameVirtualHost. now if I open that vhosted domain, I get contents of main domain.
12:06<gary4gar>I wonder why It does not give me contents of webroot of that vhost domain, which I am opening in the broswer
12:09<gary4gar>anyone has a clue why is this happening, its wierd
12:09<palintheus>restart apache?
12:10<adj>gary4gar: how did you set NameVirtualHost?
12:10<gary4gar>adj: Yes, I did
12:11<gary4gar>palintheus: restarting seems a good idea, let me try
12:11<adj>HOW?
12:11<adj>what is the value you set for the namevirtualhost directive?
12:11<gary4gar>Port 80
12:11*adj facepalms
12:12<adj>ok. i'm going to lunch. good luck
12:14-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
12:14<gary4gar>adj: if you are still there, I added this line "NameVirtualHost *:80"
12:15<gary4gar>palintheus: no effect, still the same
12:16<bob2>pastebin your entire config
12:16<bob2> /topic
12:16<gary4gar>k
12:16-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
12:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
12:18-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
12:20<gary4gar>here is the http.cong
12:20<gary4gar>http://p.linode.com/3191
12:23<amitz>litwol|mac: I'm currently lagging, new kernel updates and some readings :-) probably later.
12:23-!-kenichi [~kenichi@199.223.126.66] has joined #linode
12:23<litwol|mac>lawl k :)
12:27-!-Jonno [~Jonno@i-83-67-28-21.freedom2surf.net] has joined #linode
12:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
12:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
12:31-!-bbeausej_ [~bbeausej@mirage.turbulent.ca] has quit [Quit: Leaving...]
12:31<randallman>If chewbacca lives on endor, you must acquit
12:33<pbryan>Ah man, not the Chewbacca Defense™ again!
12:33<randallman>heh
12:33<pbryan>That's like rock, scissors, paper, bazooka!
12:35<linbot>New news from forums: Advice on Webserver for Linode 720 in Linux, Apache, Mysql and PHP (LAMP) Forum <http://www.linode.com/forums/viewtopic.php?t=4821>
12:35-!-irgeek [~jcsincla@mt-elbert.irgeek.com] has quit [Quit: leaving]
12:36-!-irgeek [~jcsincla@mt-elbert.irgeek.com] has joined #linode
12:36-!-mode/#linode [+o irgeek] by ChanServ
12:38-!-Tallken [~f2f93bf57@93.102.89.232.rev.optimus.pt] has joined #linode
12:38<gary4gar>here is the http.conf
12:38<gary4gar>http://p.linode.com/3191
12:39<gary4gar>I have a problem with apache virtual host configration. Its a new centos server, I added new vhost as NameVirtualHost. now if I open that vhosted domain, I get contents of main domain.
12:39<gary4gar>I wonder why It does not give me contents of webroot of that vhost domain, which I am opening in the broswer
12:40-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
12:42-!-RSully [~RSully@ip72-192-15-149.ri.ri.cox.net] has joined #linode
12:42-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
12:45-!-Guest1660 is now known as meff
12:46-!-meff is now known as Guest1666
12:46-!-Jonno [~Jonno@i-83-67-28-21.freedom2surf.net] has quit [Read error: Connection reset by peer]
12:48-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
12:48-!-Jonno [~Jonno@i-83-67-28-21.freedom2surf.net] has joined #linode
12:48-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
12:55-!-bbeausej [~bbeausej@mirage.turbulent.ca] has joined #linode
13:00-!-bronson [~bronson@c-76-102-7-102.hsd1.ca.comcast.net] has quit [Read error: Connection reset by peer]
13:01-!-future_linoder [~80d2b17c@webuser.linode.com] has joined #linode
13:02<future_linoder>quick question for anyone: what is the average ram usage for a fresh arch or debian linode?
13:04<litwol|mac>32 or 64 bit ?
13:04<Jonno>I think fresh debian used 60~80
13:04<future_linoder>32
13:04<litwol|mac>stripped down or with packages preselected during first install ?
13:04<future_linoder>stripped down
13:05<future_linoder>maybe just openssh
13:06-!-HedgeMage [~HedgeMage@c-67-186-107-186.hsd1.il.comcast.net] has joined #linode
13:07<sullen>my L540 is working better than my mosso 1024 instance... how the fuck does that happen?
13:10-!-Turl [~Turl@host180.190-138-110.telecom.net.ar] has joined #linode
13:10-!-TheJoe is now known as TheJoe|ZzZz
13:11-!-orudie [~paul@ool-4b7f8ec4.static.optonline.net] has joined #linode
13:11-!-steffan [10341@steffan.netrep.oftc.net] has joined #linode
13:12<litwol|mac>!urmom
13:12<linbot>litwol|mac: Yo momma's so old, she makes Slackware look like beta software. (731:7/2) [umrom]
13:12<litwol|mac>!urmom
13:12<linbot>litwol|mac: Yo momma's so dumb, she tried to exorcize the daemons from her Linode! (751:4/1) [murom]
13:12<mwalling>!urmom vote down 731
13:12<linbot>mwalling: Voted down 731 [rmumo]
13:22-!-future_linoder [~80d2b17c@webuser.linode.com] has quit [Remote host closed the connection]
13:24-!-laser` [~laser@dyn245212.shef.ac.uk] has joined #linode
13:27-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
13:28-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
13:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
13:29-!-rossbates [~rossbates@75-49-157-65.lightspeed.dllstx.sbcglobal.net] has joined #linode
13:29-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
13:30-!-rossbates [~rossbates@75-49-157-65.lightspeed.dllstx.sbcglobal.net] has quit []
13:30-!-rascal999 [~d409685a@webuser.linode.com] has joined #linode
13:30<rascal999>how long does activation take?
13:31<mwalling>should be instant unless there was something that made the monkeys suspicious
13:31<JshWright>paranoid monkeys...
13:32<rascal999>on login page says -- Your account is currently pending activation --
13:32<mwalling>check the email you used to sign up
13:33<rascal999>i have recieved invoice and recepit
13:34<JshWright>mwalling: caught a good job the other night: http://imagebin.org/71335
13:34<JshWright>rascal999: you could try poking one of the ops
13:34<JshWright>!ops
13:34<linbot>Users with ops are employees of Linode, and know what they're talking about. The rest of us are the ever-so-helpful(?) community.
13:34<mwalling>rascal999: hang out here for a bit then. spammers dont usually come on irc to activate their accounts
13:35<mwalling>JshWright: bastard
13:37<rascal999>mwalling: you think I'm a spammer?
13:37<mwalling>rascal999: no
13:38<mwalling>rascal999: but the paronoid monkeys think you might be
13:38<mwalling>rascal999: (aka, they rolled a die and it came up between 1 and 6)
13:38-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
13:38<JshWright>rascal999: are you outside the US?
13:39<mwalling>JshWright: Leicester, UK
13:39<rascal999>JshWright, yes, and my email may raise suspicion I suppose. It has the word smiles in it
13:39<rascal999>mwalling... how?
13:39<JshWright>rascal999: /whois
13:39<mwalling>rascal999: no one is anonymous on the internet
13:39<rascal999>mwalling, they are if they're behind 7 proxies ;)
13:40<mwalling>nope
13:40<rascal999>mwalling, i wish i had 7 proxies to prove you wrong :)
13:40-!-supine [~marty@dslb-094-219-217-177.pools.arcor-ip.net] has quit [Quit: Leaving.]
13:41<Jonno>It's the concept of people in Leicester smiling thats suspicious :)
13:41<@mikegrb>lolz
13:41<rascal999>Jonno, lol leave me alone :(
13:41<rascal999>one of the reasons I'm getting a vps is so i can mask that fact
13:41-!-Turl [~Turl@host180.190-138-110.telecom.net.ar] has quit [Quit: Leaving.]
13:41<Jonno>I'm from UK too, setup was pretty instant
13:42<rascal999>Jonno, *cough* watch Hulu? *cough*
13:42<JshWright>rascal999: you also gave away quite a bit by using an easily googled nick...
13:42<rascal999>JshWright, yeah, I'm not hiding, much
13:42<Jonno>hah - no I don't, but now you mention it, it isn't a bad idea
13:42<rascal999>if there are details about me i don't want you to know, you won't know them :)
13:43<JshWright>Dude, I know your name and where you live...
13:43<rascal999>but you don't know my personal email
13:43<rascal999>or mobile number
13:43<mwalling>not hard to get
13:43<Jonno>yeah but he knows you have a fourth nipple
13:44<rascal999>i've already challenged some ppl like you over on freenode to obtaining my personal email address, they failed
13:44<mwalling>i didnt say that i could get it (or that i want to), but its not hard to get
13:44<JshWright>rascal999: I'm not nearly motivated enough
13:45<rascal999>JshWright, even if you were, I have doubts
13:45<JshWright>if I really cared that much, a little social engineering would be more than enough to sort it out
13:45<JshWright>you have no friends?
13:45<rascal999>JshWright, go for it
13:45<JshWright>rascal999: I have nothing to prove, and I care a lot less than you think I do
13:45<rascal999>JshWright, nope, no friends or family, they all got abducted
13:45<JshWright>heh
13:46<rascal999>JshWright, As you already know, I'm a student on a security course, social engineering would be hard
13:46-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
13:46-!-new_user [~4df2dccf@webuser.linode.com] has quit [Remote host closed the connection]
13:46-!-Guest1666 is now known as meff
13:47-!-meff is now known as Guest1674
13:47-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
13:48-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
13:49<rascal999>!help
13:49<linbot>rascal999: (help [<plugin>] [<command>]) -- This command gives a useful description of what <command> does. <plugin> is only necessary if the command is in more than one plugin.
13:50<rascal999>how may I contact an op? Just wait?
13:51<mwalling>just wait
13:51<mwalling>they're all idle, probably staff meeting
13:57<rascal999>which is closest to NE coast? Dallas, Freemont, Atlanta, Newark?
13:57<JshWright>ark
13:57<JshWright>s/ark/Newark/
13:58<rascal999>JshWright, thanks
13:58<JshWright>stupid wheel mouse likes to scroll down randomly once in a while...
13:58-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has joined #linode
14:05<rHn_>anyone here used bitmasks?
14:05<JshWright>rHn_: in what context?
14:05<rHn_>im trying to store 2 values in 1 int and then unpack them again
14:05-!-cpg [~cpg@c-76-126-208-117.hsd1.ca.comcast.net] has joined #linode
14:05<rHn_>a length and a type, length can be any value, type is either 1 or 2
14:05<tonyyarusso>rHn_: I messed with them once.
14:06<tonyyarusso>rHn_: Boolean values?
14:06<rHn_>int values
14:06<JshWright>yeah, bitmasking is only useful for boolean values
14:06<tonyyarusso>um, yeah
14:06<tonyyarusso>I suppose you could do it for other things if you know their size, but it seems silly.
14:07<rHn_>ok, so what is type was either true or false?
14:07<tonyyarusso>come again?
14:08<adj>what language are you using that requires you to use bitwise logic to optimally store such simple data types?
14:09<rHn_>say length is 100, and type is 1 or 0, can that be stored in a single int?
14:09-!-steffan [10341@steffan.netrep.oftc.net] has quit [Quit: ]
14:09-!-steffan [10341@proton.oftc.net] has joined #linode
14:09<rHn_>and then unpacked
14:09<tonyyarusso>why would the length be 100?
14:09<adj>100 digits is a HUGE number
14:10<rHn_>length is an int
14:10<rHn_>also
14:10<JshWright>length is an int with a value of 100?
14:10<adj>100 is much larger than an int
14:10<rHn_>as in length of a string
14:10-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
14:10<rHn_>oh man, im getting confused
14:10<adj>rHn_: you are confusing yourself by doing something that isnt really necessary
14:11<JshWright>rHn_: what language are we dealing with?
14:11<adj>if its c use a struct
14:11<rHn_>java
14:11-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has joined #linode
14:11<adj>just make a class
14:11<adj>that holds the type as a boolean, and the value as an int
14:11<rHn_>adj: you're right, i missed out the solution
14:11-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
14:11<sefz>hi, i've installed ubuntu on my linode... apt-get can't find anything... anyone has a good repository?
14:11<sefz>i did
14:12<pbryan>sefz: etc /etc/apt/sources.list
14:12<pbryan>Err, edit.
14:12<adj>rHn_: then if you need to pack/unpack have your class implement Serializable
14:12<pbryan>You'll see universe is commented-out.
14:12<Jonno>rHn_: If it has to be a bitmask, you can use BigInteger for a 100 digit int
14:12<sefz>i uncomment universe?
14:12<pbryan>Yes.
14:12<pbryan>And apt-get update.
14:12<sefz>thank you
14:12<pbryan>NP
14:13<rHn_>alright, thanks
14:14-!-MrGeneral [~MrGeneral@bl8-255-53.dsl.telepac.pt] has quit [Ping timeout: 480 seconds]
14:15-!-MrGeneral [~MrGeneral@bl5-239-145.dsl.telepac.pt] has joined #linode
14:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
14:18-!-mib_4n9s4k0x [50d6fe45@webchat.mibbit.com] has joined #linode
14:19-!-mib_4n9s4k0x [50d6fe45@webchat.mibbit.com] has left #linode []
14:22<randallman>zomg
14:22<randallman>there's a mold problem on the 1st floor
14:22<randallman>and so now all of these business-type or phone-type people are moving into our area
14:22<randallman>wtf
14:22<randallman>when WE lived on the 1st floor, noone cared when we said we smelled mold
14:23<path>heh.. watch your mouth :)
14:23<randallman>yeah that's the fucking problem god damnit :)
14:23<randallman>we're a bunch of loud mouth bastards here in IT :)
14:27-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
14:28<path>are you on the corner of 141 and lancaster?
14:28<randallman>no
14:28<randallman>that's delle don
14:28<@mikegrb>lolz
14:28<randallman>lol
14:28<path>oh
14:28<randallman>we're in little falls
14:28<path>OH
14:28<randallman>we USED to be in delle don
14:29<randallman>long ago
14:29<randallman>back when you were my CEO's neighbor :p
14:29<path>yea
14:29<path>back in the day
14:29<path>so you're next to artisans
14:29<path>or down further near brookmeade?
14:29<randallman>Sorta kinda
14:30<path>i grew up in brookmeade actually
14:30<path>lived there 1st through 3rd grade
14:30<randallman>artisans is at 41/48 and centerville
14:30<randallman>then little falls 3 is directl across from seimens
14:30<path>used to walk to the 7-11 in the summer to get candy
14:30<randallman>little falls 1 and 2 is right across from connley bove?
14:31<randallman>or whoever they are, the realestate attorneys
14:31<randallman>We're the last set of buildings before the neighborhood
14:31-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has quit [Ping timeout: 480 seconds]
14:31<randallman>so if that's brookemeade, sure
14:31<path>yea.. i used them.. wardconley
14:31<randallman>ok wardconley
14:31<randallman>yeah we're right across from them
14:31<path>cool
14:32<path>i gotta run to get my speed control deactivation switch replaced
14:32<path>appoint in a bit
14:32<path>so my ford doesn't catch fire
14:32<randallman>heh
14:32<randallman>exploder :P
14:32<path>ha
14:32<path>ttyl :)
14:34<gary4gar>I have a problem with apache virtual host configration. Its a new centos server, I added new vhost as NameVirtualHost. now if I open that vhosted domain, I get contents of main domain.
14:34<gary4gar>I wonder why It does not give me contents of webroot of that vhost domain, which I am opening in the broswer
14:34<gary4gar>here is the http.conf
14:34<gary4gar>http://p.linode.com/3191
14:34<gary4gar>Please help
14:34-!-amrnt [~d506d3ed@webuser.linode.com] has joined #linode
14:35<randallman>gary, I assume you're trying to use www.jaipurboys.com to get to the content?
14:36<gary4gar>yes
14:36<amrnt>hi.. please am soo new bie
14:36<randallman>I get assivia network speed test
14:36<amrnt>any help?
14:36<gary4gar>That's the issue
14:37<randallman>What's the FQDN of the box?
14:37<randallman>just wondering.
14:38-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
14:38<gary4gar>randallman: you mean the ServerName?
14:38-!-rascal999 [~d409685a@webuser.linode.com] has quit [Remote host closed the connection]
14:38<gary4gar>its set to server.assiva.net
14:38-!-atambo [~atambo@ATAMB0.RES.CMU.EDU] has joined #linode
14:38<gary4gar>But I don
14:39<randallman>The actual FQDN of the box
14:39<randallman>just wondering.
14:39<gary4gar>But somehow apache is not serving Documentroot of Jaipurboys.com. instead its using default Web root
14:39<randallman>Well it doesnt even seem to be matching that vhost
14:39<randallman>Whatlogfile is it writing to?
14:39<randallman>the jaipurboys.com one or?
14:40<gary4gar>randallman: Checking...the log file and hostname. Thanks for pointers. Hold on
14:40<randallman>cat /etc/hosts :P
14:40<randallman>or some such
14:41-!-amrnt [~d506d3ed@webuser.linode.com] has quit [Remote host closed the connection]
14:42<gary4gar>randallman: its assiva.net
14:42<gary4gar>the Hostname
14:42<randallman>Ok weird
14:42<randallman>so the logs
14:42<randallman>is it writing to the jaipurboys.com logfile or
14:42<gary4gar>checking...
14:42<randallman>your primary server logs?
14:42<randallman>I also assume you've done an apachectl restart
14:42<adj>is it possible that apache doesnt have permissions to read your home dir?
14:42<adj>perhaps home is o-x
14:43<randallman>But would it default to the main server docroot in that case?
14:43<randallman>you'd just egt 403...
14:43<randallman>(AFAIR)
14:43<randallman>(as far as I reason)
14:43<gary4gar>randallman: logs for jaipurboys.com are empty
14:43<adj>randallman: i would expect a 403, but the conf looks right
14:43<randallman>the conf does look right
14:43<randallman>at a cursory glance.
14:43<randallman>YOu have restarted it gary?
14:43<gary4gar>adj: I did chmod -R 755 on the home dir, so can't be a permission issue
14:44<gary4gar>randallman: yes, multiple times
14:44<randallman>the entire homedir, or just the DocuemntRoot?
14:44<gary4gar>entire home dir
14:44-!-el_syn [~syn@62.149.40.4] has quit [Quit: brb lol]
14:45<randallman>anything in the normal error logs?
14:45-!-tizzo [~tizzo@c-76-124-125-224.hsd1.pa.comcast.net] has joined #linode
14:45<randallman>about misconfiguration?
14:45<randallman>And is this a standard unbuntu distro?
14:45<randallman>is there a conf.d and sites-enabled section?
14:45<gary4gar>Its centOS
14:45<randallman>Oh ok
14:45<randallman>so there's an /etc/httpd/conf.d directory
14:45<gary4gar>Check the main logs
14:46<gary4gar>Indeed, there is
14:46<gary4gar>checking*
14:46<randallman>Anything in there that might be overruling your settings?
14:46-!-tizzo [~tizzo@c-76-124-125-224.hsd1.pa.comcast.net] has quit []
14:46-!-massive [~5c7700df@webuser.linode.com] has joined #linode
14:47-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
14:47<gary4gar>randallman: I think I found something
14:47-!-Guest1674 is now known as meff
14:47<gary4gar>[warn] Init: You should not use name-based virtual hosts in conjunction with SSL!!
14:47<sefz>i've followed this guide for lighttpd: http://www.ubuntugeek.com/lighttpd-webserver-setup-with-php5-and-mysql-support.html but when i try to open the testpage, it says 403 - Forbidden . Why that?
14:48-!-meff is now known as Guest1679
14:48<gary4gar>Hold on, posting the complete log file
14:48-!-syn [~syn@62.149.40.4] has joined #linode
14:48-!-syn is now known as el_syn
14:49<gary4gar>randallman: this is the error log --> http://p.linode.com/3192
14:50-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has quit [Read error: Connection timed out]
14:50<gary4gar>not much interesting in access_log
14:50-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has joined #linode
14:50<sefz>i've followed this guide for lighttpd: http://www.ubuntugeek.com/lighttpd-webserver-setup-with-php5-and-mysql-support.html but when i try to open the testpage, it says 403 - Forbidden . Why that?
14:51-!-steffan_ [10341@proton.oftc.net] has joined #linode
14:51-!-steffan_ [10341@proton.oftc.net] has quit []
14:52-!-orudie [~paul@ool-4b7f8ec4.static.optonline.net] has quit [Quit: Leaving]
14:52<Karrde>too-stringent permissions
14:52<sefz>so what can I do?
14:52<adj>gary4gar: your problem is plesk
14:52<randallman>Oh hmm
14:52<randallman>you're using SSL too?
14:52<adj>randallman: plesk has taken over conf.d
14:52<randallman>Ahh I see now
14:53<randallman>What is plsek anywho?
14:53<adj>if you use plesk, you must use plesk for everything. no mixing and matching
14:53<adj>so log into plesk and config the vhost there
14:53<randallman>Oh it's like some type of apache configuratorator
14:53<adj>its like webmin
14:53<@mikegrb>lolz
14:53<gary4gar>Yeah, Its installed but I don't use it. I don't even remember the password. lol
14:53<gary4gar>does anyone how to login?
14:54<adj>gary4gar: the moment you installed plesk your system stopped being cetnos
14:54<gary4gar>oh
14:54<randallman>Is it just for apache?
14:54<randallman>or is it a total soup to nuts?
14:54<adj>total
14:54<spkitty>plesk is terrible
14:54<gary4gar>its actually my hosting provider, they said managing would be easier
14:54<spkitty>mediatemple insists on it in being installed as default on all profiles
14:54-!-massive [~5c7700df@webuser.linode.com] has quit [Remote host closed the connection]
14:55-!-nard [~nard@141.117.160.207] has joined #linode
14:55<spkitty>gary4gar: command line is so much easier than plesk, plesk is slow, takes up resources and just plain obtuse in finding out how to change any settings
14:55<gary4gar>also, there are other people who use this server, they installed it
14:55<spkitty>ah, well fair enough then
14:55<gary4gar>I guess I have live with it
14:55-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
14:55-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
14:55<adj>gary4gar: you will have to work with them to accomplish what you want
14:56<adj>because hacking around plesk is non-trivial
14:56<gary4gar>how login into plesk? I have the root passoword
14:56<gary4gar>I tried logging but it didn't work
14:56<spkitty>:8443
14:56<adj>i have no idea. i think i have installed plesk once, maybe
14:57<gary4gar>I tried Username:root and password:<my root password> but it says wrong username password
14:58<gary4gar>I am sure, once I get in. I can configure domains.
14:58<spkitty>that should be all you need
14:58<adj>does plesk auth through pam?
14:58<spkitty>i can only imagine the people you share the server with changed default settings
14:58<gary4gar>There must be someway to find out what login details are, they must store the logins something in shadow file or in database
14:59<adj>gary4gar: why not just ask them ;)
14:59<gary4gar>Since, I have full root level access, Maybe I can reset it
14:59<gary4gar>adj: they are management people. they won't have a clue.
15:00<spkitty>is root login disabled on your box?
15:00<gary4gar>no
15:00<spkitty>don't know then sorry, never fucked around with plesk settings - just hated it too much
15:00<gary4gar>hehe
15:01<gary4gar>then, I would fuck plesk tonight :P
15:01<adj>i'd like to see the statistics on rooted boxes running plesk (or other management crap) vs boxes without plesk
15:02<SelfishMan>adj: that assumes that the people running those apps actually know they have been rooted
15:02<SelfishMan>or even more so, it assumes they actually care
15:02<adj>oh. i never expected those numbers to be self reported ;)
15:02<randallman>Im glad it sucks
15:02<randallman>or I woldnt have a job :0
15:02<randallman>If there were some magic GUI to manage RedHat boxes :)
15:03<randallman>gary, best soltion is to buy a new linode :0
15:03<linbot>New news from forums: do you need a Domain name vs just IP address in General Discussion <http://www.linode.com/forums/viewtopic.php?t=4827>
15:03*randallman puts on a salesdroid hat
15:06<gary4gar>randallman: I have more faster solution
15:07<randallman>mofasta
15:07*gary4gar thinks to run "rm -rf /"
15:07<randallman>That wont be useful
15:07<gary4gar>this fuck plesk :P
15:07<adj>nah. that never finishes
15:07<randallman>relax mate
15:07<gary4gar>I am just joking
15:07<gary4gar>The server contains lot of important data, I just can't wreck it
15:12<randallman>damnit, my headphones are dying
15:14-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
15:14-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
15:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
15:18-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
15:19-!-steffan [10341@steffan.netrep.oftc.net] has quit [Quit: ]
15:20-!-daMaestro [~jon@content.beatport.com] has quit [Ping timeout: 480 seconds]
15:20-!-borat [~wjesus@host223-107-dynamic.36-79-r.retail.telecomitalia.it] has joined #linode
15:21<borat>hi
15:22-!-dajhorn [~chatzilla@user-0cet72i.cable.mindspring.com] has joined #linode
15:26-!-daMaestro [~jon@content.beatport.com] has joined #linode
15:27-!-cdlu [~cdlu@cdlu.ombudsman.oftc.net] has quit [Ping timeout: 600 seconds]
15:27-!-cdlu [~cdlu@ottawa-hs-64-26-156-90.s-ip.magma.ca] has joined #linode
15:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
15:28-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
15:28-!-hammockhero [~hammockhe@180.72.38.26] has joined #linode
15:32<nard>hai five!
15:34-!-borat [~wjesus@host223-107-dynamic.36-79-r.retail.telecomitalia.it] has quit [Ping timeout: 480 seconds]
15:37-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
15:37-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
15:48-!-Guest1679 is now known as meff
15:49-!-meff is now known as Guest1685
15:49-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has joined #linode
15:56-!-bbeausej [~bbeausej@mirage.turbulent.ca] has quit [Read error: Connection reset by peer]
16:01-!-elfgoh [~dingding@adsl252.dyn212.pacific.net.sg] has quit [Quit: Leaving]
16:02<adj>woohoo
16:02<adj>snow leopard is nearly done installing ;)
16:03-!-superkuh [~hukrepus@c-24-245-50-49.hsd1.mn.comcast.net] has quit [Remote host closed the connection]
16:03<pbryan>Snow Leopard on a Linode! Cool!
16:03<adj>no. not on a linode ;)
16:03<JshWright>post a HOWTO!
16:03<pbryan>Ah. Too bad.
16:04<pbryan>You're just installing it on a Mac? How ordinary.
16:04<adj>well... its new to me ;)
16:04<pbryan>:)
16:05<adj>os x on a linode would be... gross
16:05<pbryan>It would at least be novel.
16:05<adj>true
16:07-!-new_customer [~4df2dccf@webuser.linode.com] has joined #linode
16:07<linbot>New news from forums: Ftp\http\Citadel don't work in Feature Request/Bug Report <http://www.linode.com/forums/viewtopic.php?t=4828>
16:07<new_customer>hi
16:07<new_customer>i buy today a linode
16:07<new_customer>i install fedora
16:08<mwalling>thats nice
16:08<new_customer>a program like qmailtaster
16:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
16:08<new_customer>to install?
16:08-!-Jonno [~Jonno@i-83-67-28-21.freedom2surf.net] has left #linode []
16:08<JshWright>new_customer: I'm not sure what your question is...?
16:09<new_customer>i need to install ma multihost mail server with contro panel
16:09<new_customer>ideas?
16:09<mwalling>http://library.linode.com/email-guides/
16:10-!-MarkJ [~mark@dev.daelhoof.com] has quit [Quit: leaving]
16:11<mwalling>otherwise, (in most cases) there's no difference between installing software on a linode and installing it on a machine sitting in your lap
16:11-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
16:11<new_customer>zimbra is multi-hosts?
16:12<mwalling>that doesnt make sense
16:13-!-TheJoe|ZzZz is now known as TheJoe
16:14-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has quit [Read error: Connection reset by peer]
16:14-!-amrnt [~amrnt@a211-237.adsl.paltel.net] has joined #linode
16:15<amrnt>hello
16:15<amrnt>can i transfare my linode?
16:15<mwalling>A Transfare is an inter-modal ticket available for a single journey within Tyne and Wear.
16:16<Karrde>I assume he means transfer
16:18<amrnt>well, i meant for example from Atlanta servers to Dallas
16:18-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
16:18<Karrde>yes
16:18<Karrde>enter a ticket
16:19<mwalling>!migration
16:19<linbot>Linodes can be migrated between datacenters by simply opening a ticket. Your disk images will be copied intact, but you will be issued a new IP address. Once a migration is configured, it makes a button on the dashboard available for you to start the migration yourself. Migration typically takes about 1-3 minutes per GB.
16:19-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
16:20-!-danny [~d506d3ed@webuser.linode.com] has joined #linode
16:20<@mikegrb>mmm cake
16:20<pbryan>!cake
16:21-!-amrnt [~amrnt@a211-237.adsl.paltel.net] has quit [Quit: Leaving]
16:21-!-amrnt [~amrnt@a211-237.adsl.paltel.net] has joined #linode
16:21<danny>hi
16:22<pbryan>hi
16:22<amrnt>anybody might answer me?
16:22<Karrde>amrnt: we did
16:22<Karrde>twice
16:23<jforman>amrnt: thats what !migration just told you. you said you want to move from atlanta to dallas..that's a migration
16:23<mwalling>!migration
16:23<linbot>Linodes can be migrated between datacenters by simply opening a ticket. Your disk images will be copied intact, but you will be issued a new IP address. Once a migration is configured, it makes a button on the dashboard available for you to start the migration yourself. Migration typically takes about 1-3 minutes per GB.
16:23<amrnt>i want to transfer my linode from Atlanta to Fremont
16:24<Karrde>so do so
16:24<mwalling>!migration
16:24<linbot>Linodes can be migrated between datacenters by simply opening a ticket. Your disk images will be copied intact, but you will be issued a new IP address. Once a migration is configured, it makes a button on the dashboard available for you to start the migration yourself. Migration typically takes about 1-3 minutes per GB.
16:24<Karrde>*whines* mwalling is spamming
16:24<mwalling>!urmom
16:24<linbot>mwalling: Yo momma's so big, she knocked Mir out of orbit (805:0/2) [mmoru]
16:24<amrnt>how?, again?
16:24<mwalling>!migration
16:24<linbot>Linodes can be migrated between datacenters by simply opening a ticket. Your disk images will be copied intact, but you will be issued a new IP address. Once a migration is configured, it makes a button on the dashboard available for you to start the migration yourself. Migration typically takes about 1-3 minutes per GB.
16:24<pbryan>amrnt: open a ticket.
16:24<jforman>mwalling: please stop
16:24<mwalling>not until he reads it
16:25<amrnt>got it!
16:25<pbryan>I've read it four times now!
16:25-!-amrnt [~amrnt@a211-237.adsl.paltel.net] has quit []
16:25<pbryan>!mwalling
16:25<linbot>find . -user mwalling | xargs rm -v
16:25-!-amrnt [~d506d3ed@webuser.linode.com] has joined #linode
16:27-!-danny [~d506d3ed@webuser.linode.com] has quit [Remote host closed the connection]
16:29<straterra>hmm
16:30<straterra>can someone do me a favor and see what time it is in china?
16:30<mwalling>straterra: cant you look at your watch?
16:30<straterra>no
16:30<straterra>i dont have my watch...or a clock here
16:30<mwalling>i see 5:30 am
16:31<mwalling>straterra: dont you still have a treo?
16:31-!-jcn [~jcn@rrcs-208-105-67-138.nyc.biz.rr.com] has quit [Ping timeout: 480 seconds]
16:31-!-amrnt [~d506d3ed@webuser.linode.com] has quit [Remote host closed the connection]
16:31<mwalling>straterra: palmos says 5:30 am on wednesday
16:31-!-hammockhero [~hammockhe@180.72.38.26] has quit [Quit: hammockhero]
16:33-!-RSully [~RSully@ip72-192-15-149.ri.ri.cox.net] has quit [Ping timeout: 480 seconds]
16:33<straterra>ok ty
16:36-!-Tallken [~f2f93bf57@93.102.89.232.rev.optimus.pt] has quit [Quit: Leaving]
16:37-!-amrnt [~d506d3ed@webuser.linode.com] has joined #linode
16:45<bob2>straterra: google "time in beijing" (or whatever)
16:45<straterra>if i had a working browser... :)
16:46-!-amrnt [~d506d3ed@webuser.linode.com] has quit [Remote host closed the connection]
16:47<JshWright>so, anyone have a Linode Android app?
16:47<Nivex>!f time in beijing
16:47<linbot>Nivex: 5:47:56 am CT | Thursday, November 12, 2009
16:48-!-orudie [~paul@ool-4b7f8ec4.static.optonline.net] has joined #linode
16:49-!-RSully [~RSully@pool-74-97-182-218.prvdri.fios.verizon.net] has joined #linode
16:49-!-Guest1685 is now known as meff
16:49<randallman>o/~ If I had a working browser o/~ (set to 'if i had a million dollars')
16:50-!-meff is now known as Guest1690
16:51-!-ubuntuisloved [~jason@fw.sgstestcom.com] has quit [Ping timeout: 480 seconds]
16:51-!-Guspaz|m [cffdca03@webchat.mibbit.com] has joined #linode
16:53<randallman>Guspaz!
16:53<mwalling>JshWright: screw you and your droid
16:54<randallman>I wanted to share - mixed dimm sizes per channel IS supported
16:54<randallman>as logn as all channels are equally mixed ;)
16:54<JshWright>mwalling: it's my wife's droid
16:54<mwalling>heh
16:54<JshWright>screw her and we're gonna have issues, k? ;)
16:54<mwalling>heh
16:54<randallman>e.g. channel 1 has 2 dimms, channel 2 has 2, channel 3 has 3.... Each of them is an 4 and a 2... so 6GB per channel, total of 18GB...
16:54<randallman>err channel 3 has 2 :P
16:55<randallman>Guspaz, and also HP has allowed for override of the speed-down when using > 1 DIMM per channel (1333 to 1066 when using 2 per channel and 1333 to 800 when using 3 in a channel)
16:57<randallman>JshWright, I used a buddies Droid today - and YES...
16:57<randallman>the keyboard is NEARLY as usable as the BBerry...
16:57-!-Turl [~Turl@host180.190-138-110.telecom.net.ar] has joined #linode
16:57<randallman>I think it will do just fine for the morning constitution soliloquy. :P
16:57<orudie>porn http://upload.wikimedia.org/wikipedia/commons/d/df/Body_painting.JPG
16:59<RSully>sup guys
17:00*Bdragon reduces the problem to an already solved joke.
17:00<Pryon>haha
17:00<@mikegrb>lolz
17:00<RSully>lol
17:00<RSully>xD
17:03<randallman>Dude that picture
17:03<randallman>I dunno if I should vomit or nto :)
17:03<orudie>why ?
17:04<orudie>she is kinda cute
17:04<randallman>You think?
17:04-!-q[rGeoffrey] [~chatzilla@8.20.80.6] has quit [Read error: Connection reset by peer]
17:04<orudie>anyone, i gotta get out of here
17:04<orudie>well my gf is cutter, but i would do her :)
17:04<randallman>that
17:04<randallman>that's 6 beers :P
17:04<randallman>Minimum :)
17:04<orudie>of course
17:05<TheJoe>http://www.youtube.com/watch?v=5qYY06KD_Zg Oh, Internet
17:05-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
17:05-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has joined #linode
17:06<TheJoe>http://www.youtube.com/watch?v=T2E69k7BYd8
17:06<TheJoe>Wrong channel, that one
17:06-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
17:07-!-borat [~wjesus@host223-107-dynamic.36-79-r.retail.telecomitalia.it] has joined #linode
17:07<borat>hello
17:07-!-MarkJ [~mark@dev.daelhoof.com] has joined #linode
17:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
17:08-!-Holstein [~BenC@mirage.turbulent.ca] has quit [Quit: Holstein]
17:10-!-new_customer [~4df2dccf@webuser.linode.com] has quit [Remote host closed the connection]
17:11-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
17:12-!-Turl [~Turl@host180.190-138-110.telecom.net.ar] has quit [Quit: Leaving.]
17:15<borat>i'm looking for someone with a bit of experience to help me to choose a good vps plan for my needs
17:15<adj>you're in the right place
17:15<borat>sorry for my awkward engl
17:15<borat>:p
17:15<borat>eheh i know ;)
17:17-!-gary4gar [~gaurish@59.95.190.254] has quit [Quit: Lost terminal]
17:17<borat>so.. i'm looking for an hosting plan for a small website but with a large load of users/visitors
17:18<borat>i've got 3 php pages
17:18<bob2>you need to mention specific numbers
17:18<borat>with no database
17:18<bob2>and specific apps
17:18<borat>image hosted on imageshack
17:19<borat>mh
17:20<borat>i need only a webserver with basic modules
17:20<borat>no mod_rewrite etc
17:21<borat>with about 800 people constantly online
17:21<borat>that idle in most cases
17:22<borat>or don't spend resources anyway
17:22<@mikegrb>lolz
17:22<borat>(i also need an english course lol)
17:23<Pryon>your english is fine
17:23<borat>eh thanks
17:23<DephNet[Paul]>your english is better than some english people
17:24<@mikegrb>lolz
17:24<borat>but i've my google translator w/me LOL
17:24<borat>anyway
17:24<Guspaz|m>800 simultaneous users with non-persistent connections? Anything could handle. With persistent connections? Apache will keel over.
17:25<borat>uhm
17:25<Twayne>.
17:26<Guspaz|m>Hosting your images on ImageShack: keep in mind that ImageShack has very low bandwidth restrictions, so you won't be able to host your sites' images there.
17:26-!-getsmart [~getsmart@88-149-240-33.dynamic.ngi.it] has quit [Quit: Ex-Chat]
17:26<borat>i think that the real load is 100 connections
17:26<Guspaz|m>All your visitors will simply see the "Bandwidth exceeded" image.
17:26<adj>borat: what kind of resources are you currently using?
17:26<borat>others idle reading the contents
17:26-!-ph_ [~ph^@cm-84.211.180.8.getinternet.no] has quit [Remote host closed the connection]
17:27<Guspaz|m>It sounds like any sized Linode with lighttpd or nginx should be able to handle that just fine, but somebody here will probably slap me for implying that it's easier to not use Apache for dealing with high load.
17:27-!-arthurb [~arthurb@office.rbery.bulletproof.net] has joined #linode
17:27<borat>adj now i'm on a shared hosting
17:27<adj>borat: is it holding up?
17:27<Bdragon>Or running a reverse proxy like varnish in front of the webserver..
17:28<adj>varnish is awesome
17:28<borat>yeah
17:28-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
17:28<borat>adj
17:28<Guspaz|m>varnish is awesome, but I don't think it's really required in this scenario.
17:28<adj>Bdragon: http://virtualfistbu.mp/
17:28<borat>but now i've not that load :o
17:28<adj>Guspaz|m: it would be useful for the static content only i think
17:29<Guspaz|m>adj: it would, but lighttpd and the disk cache would probably be fine for the load levels he's dealing with, and would be a simpler setup.
17:29<Guspaz|m>Or nginx.
17:29<adj>good point
17:29<Bdragon>(It does support some ESI stuff so if you have the time to goof off with page splitting you can win there)
17:29<Guspaz|m>Varnish is awesome, but if you don't need it, it's just another layer of complexity.
17:29<adj>i always tend to think in terms of "well what if the drop an ad campaign and i spike to 20k users?"
17:29<adj>s/the/they
17:30<Guspaz|m>When dealing with a small static dataset and lightweight PHP pages, I'd be more concerned about bandwidth consumption at that point.
17:30<Guspaz|m>Although he didn't say that his PHP pages were lightweight, just that there was no database involved.
17:31-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
17:32<borat>eheh
17:32<linbot>New news from forums: Ftp\http\Citadel don't work in General Discussion <http://www.linode.com/forums/viewtopic.php?t=4828>
17:32<Guspaz|m>borat: I think what we're saying is almost any sized Linode would do if properly configured, but that's probably about all we can say without additional information.
17:33<borat>about 10kb per user
17:34<borat>eheh
17:34<Guspaz|m>10 KB/s per user, with 100 users? That's a lot of bandwidth.
17:35<borat>83kb is all the website size
17:35<borat>:)
17:35<Guspaz|m>Well, without knowing how many views you get in a day...
17:35<borat>mh 100k?
17:36<Guspaz|m>But it doesn't much matter, Linode bandwidth costs scale linearly. If you need to transfer 1000GB of data, it will cost $100 per month with a Linode 360, and it will cost $100 per month with a Linode 720.
17:36<borat>50 boh
17:36<borat>now i cant preview it
17:36<Guspaz|m>Linode charges $0.10 per gigabyte overage, and the included bandwidth costs the equivalent.
17:36<borat>i think that bandwidth is not my problem .o
17:37<borat>is a very light website
17:37<Guspaz|m>50k users per day times 83KB of data is a bit over 100GB, so any Linode plan is fine. Although, consider running mod_deflate or the equivalent, it'll save bandwidth.
17:38-!-Redgore [~redgore@94-194-111-182.zone8.bethere.co.uk] has quit [Quit: Peace and Protection 4.22.2]
17:38<borat>yes i will cache contents too
17:39<Guspaz|m>Yeah, I'd say that any sized Linode will do fine if you configure it properly.
17:39<Guspaz|m>You can always upgrade later if you need more; they can resize the linode.
17:39<Guspaz|m>Actually you can resize it since it's self-serve now.
17:40<borat>but 360mb of ram aren't enough?!
17:40<Guspaz|m>Why not?
17:40<randallman>EVerybody Follows Speed Bits Exchange Stars Await to Glow
17:41<Peng>........?
17:41<Guspaz|m>PHP consumes something like 10-15 MB per process (some of that shared) and a default Lighttpd fastcgi setup has, I think, 8 instances. The web server itself doesn't use much up since it isn't doing much. That's all you're running. The rest is for disk cache.
17:41<randallman>Oracle Haiku, when tcpdumping the oracle thin client :)
17:42-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
17:42<borat>so i should try the 360?
17:43<Guspaz|m>Yeah, I'd say so. Try a 360 with Lighttpd or nginx.
17:43-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
17:43<straterra>kwin 10
17:43<borat>i see ok. thanks :)
17:43<straterra>grr
17:44<Guspaz|m>Hmm, odd, I don't have a login prompt on lish, just my boot log
17:44<Guspaz|m>And I never upgraded to Ubuntu 9.10
17:44<randallman>Guspaz, you see my comments earler about the Xeon HP nehalem getup?
17:45<Guspaz|m>About the crazy idiots using non-matching DIMMs?
17:45<randallman>no about it being supported :)
17:45<Guspaz|m>What being supported, the non-matching DIMMs?
17:45<randallman>It's actually supported :P
17:45<randallman>yeah :0
17:45<randallman>as long as the banks of all channels are identical
17:45<Guspaz|m>Just because it's supported by the platform doesn't mean it's smart.
17:45<randallman>e.g. channel 1 = 4gb + 2gb and channel 2 = 4gb + 2gb.
17:45<randallman>and channel 3 = 4gb + 2gb.
17:45<randallman>well, the issue is you cant reach many target ram sizes WITHOUT mixing it
17:46<Guspaz|m>So? Overshoot. You can never have too much RAM.
17:46-!-lesouvage [~chatzilla@82.73.69.76] has joined #linode
17:46<straterra>if you run win98 you can
17:46<Bdragon>Heh
17:46<Guspaz|m>Quiet, you.
17:46<randallman>for 1 CPU, its 6 as 3x2, 12 as 6x2, 12 as 3x4, etc...
17:46<straterra>(gets linearly slower when you add more than 512mb)
17:46<randallman>win98 with 1gb of ram!
17:47<randallman>w00t the good old days
17:47<Guspaz|m>I ran Win95 on 8MB of RAM. I had to reboot into DOS to launch games because I didn't have enough RAM.
17:47<Guspaz|m>BTW, this was after the Pentium II came out.
17:47<mwalling>straterra: tourist trap
17:47<straterra>who?
17:47<mwalling>straterra: your pandas
17:47<straterra>lies
17:47<straterra>the pandas are kickass
17:48-!-q[rGeoffrey] [~chatzilla@8.20.80.6] has joined #linode
17:48<mwalling>17:43 [@straterra:30] Just finished breakfast..the toaster here burns cute pandas in to the toast!
17:48<Bdragon>I remember cooking up boot disks to get as much conventional ram freed as possible XD
17:48<Guspaz|m>http://downlode.org/Creative/Writing/Notebook/Illustrations/itsatrap.jpg
17:48-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
17:48<mwalling>who here thinks straterra is in a tourist trap?
17:48<randallman>Guspaz, also HP can override the mandatory clock-down on more than 1 DIMM per channel
17:48<straterra>trust me...this isnt tourism area
17:48<randallman>apparently if you have 6 slots for 3 channels, and if you install all 6 dimms, it clocks down from 1333 to 1066
17:48<straterra>its tbhis chinese ladys toaster
17:49<Guspaz|m>HP is playing with dangerous voodoo.
17:49<straterra>hp is smart enough
17:49<randallman>not sure why it has to clock down
17:49<randallman>but then again I'm not a hardware wingding :)
17:49<Guspaz|m>HP rejected the Apple 2 and let Woz go off on his own to start Apple. They can't be that smart.
17:49<Bdragon>Because some guy with a soldering iron said so.
17:49<randallman>NICE! :p
17:49<randallman>2pts for Bdragon :)
17:50<Guspaz|m>Well, rejected the Apple 1, and that rejection prompted the creation of the Apple 2, but meh.
17:50<mwalling>"carrie prejean sextape video" is currently 19 in google trends
17:50<randallman>haha
17:50-!-Guest1690 is now known as meff
17:50<randallman>she isnt THAT hot
17:50<randallman>well ok she is :)
17:50<randallman>But she has HUGE FUCKING TEETH
17:51<Bdragon>Searchability?
17:51<Guspaz|m>I'll just nod and pretend I have any clue who that is.
17:51<mwalling>"why wont my parakeet eat my diarrhea" is number 3
17:51<randallman>The Ex-Ms. California
17:51<mwalling>Guspaz|m: miss america
17:51-!-meff is now known as Guest1697
17:51<randallman>She failed at that
17:51<mwalling>Guspaz|m: the one who stood up to "parez hilton"
17:51<straterra>her teeth fuck too?!
17:51<randallman>by telling that parez hilton that she didn't beleive in gay marriage
17:51<straterra>ok guys...off to work!
17:52<mwalling>i still like number three "why wont my parakeet eat my diarrhea"
17:52<Guspaz|m>Unless she was that one who made it viral by messing up her speech, I wouldn't know who was Miss California at any given time.
17:52<randallman>What kinda dumb b1tch is in a BEAUTY CONTEST decides to dis the entire gay community
17:52<Guspaz|m>Not living in the same country as California might have something to do with that.
17:52<randallman>seriously, as if her hairdresser and makeup dudes arent gay :P
17:52-!-nard [~nard@141.117.160.207] has quit [Quit: nard]
17:53<mwalling>or there is the whole standing up for what you believe in
17:53<Bdragon>http://www.askpeeves.com/
17:53<randallman>Sure mwalling :P
17:53<Guspaz|m>Oh, I vaguely recall that, then. But not what she looks like.
17:53<Guspaz|m>The Daily Show is my source of American news.
17:53<randallman>It's akin to running around in the NYC village with a 'I hate gay people' banner
17:54<randallman>Guspaz, well search google - everyone else is :)
17:54<Guspaz|m>Or Bruce Willis walking through Harlem naked with a racist sandwichboard?
17:54<randallman>Yeah exactly :p
17:55<mwalling>so she was supposed to bend over and take it from him?
17:55<Guspaz|m>Thank goodness that Shaft was there to save him.
17:57-!-lesouvage [~chatzilla@82.73.69.76] has quit [Ping timeout: 480 seconds]
17:57-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
18:03-!-amrnt [~d506d3ed@webuser.linode.com] has joined #linode
18:03-!-Guspaz|m [cffdca03@webchat.mibbit.com] has quit [Quit: http://www.mibbit.com ajax IRC Client]
18:03<Pryon>she should mind her own business
18:03<amrnt>i wanna be so cleaar about VPS at all
18:04<amrnt>i want some help
18:04<bob2>!ask
18:04<linbot>Don't ask to ask; just ASK
18:04-!-Turl [~Turl@host180.190-138-110.telecom.net.ar] has joined #linode
18:04<@mikegrb>lolz
18:04<amrnt>lol..
18:05-!-jtaji [~jtaji@174.59.115.229] has joined #linode
18:05<amrnt>okay, I want to make "for example" 2 sites each one with a spicific storage.. so i havo to mae seprate disk image?
18:05<bob2>what does "a specific storage" mean?
18:06<straterra>you could use disk quotas..or seperate partitions
18:06<amrnt>sorry for my english.. web1 = 1000MB, web2= 4000MB
18:06<Peng>amrnt: Why do you care?
18:06<bob2>reselling web hosting
18:06-!-ubuntuisloved [~jason@cpe-74-67-36-120.nycap.res.rr.com] has joined #linode
18:08-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
18:08-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
18:08-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
18:10<amrnt>ummm... what i think aboout... I have 2 sites... and i awnt for each one a limited storage...
18:10<Pryon>amrnt: yes. You can do that with partitions or with quotas
18:11<amrnt>ah. how?
18:11-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
18:12-!-jtaji [~jtaji@174.59.115.229] has quit [Remote host closed the connection]
18:14<Pryon>(1) create disk images of the desired size, install the web site in the appropriate place in the filesystem. (2) Install quota and configure the appropriate quota for the user so they can use only the amount of disk space you specify.
18:15-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Quit: Leaving]
18:15-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
18:16<amrnt>in the terminal... how to access each disk image?
18:16-!-TheJoe is now known as TheJoe|ZzZz
18:16<Pryon>What do you mean by "access"?
18:17<amrnt>access
18:17<Yaakov>You know, access.
18:17<Pryon>Assuming the images exist in your configuration profile, you use the mount command to make them accessible in the filesystem
18:18<amrnt>where i can find them?
18:18<amrnt>sorry...
18:19<amrnt>am so new bie
18:20<mwalling>maybe you should start simple then
18:20<Pryon>If you look at your configuration profile, you should see a list of images and the device files to which they correspond
18:20<Pryon>For example, your root filesystem is probably /dev/xvda
18:20<mwalling>if you run head long into a cliff with out climbing equipment, you're going to get a bruise on your forhead
18:20<amrnt>aha
18:21<Pryon>So if you create an ext3 image and it is associated with device /dev/xvda, you could do mkdir /foo; mount /dev/xvda /foo and you could access that space in /foo
18:21<Pryon>er
18:22<Pryon>mount /dev/xvdc
18:22<Pryon>or whatever the device is
18:22-!-BarkerJr [~BarkerJr@BarkerJr-2-pt.tunnel.tserv21.tor1.ipv6.he.net] has joined #linode
18:22<Pryon>Yaakov's presence causes me to make more mistakes than usual
18:24<amrnt>thanks . got it!!!
18:29-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Quit: Leaving]
18:30-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
18:30-!-jimcooncat [~jim@pool-72-65-97-56.ptldme.east.myfairpoint.net] has quit [Quit: Ex-Chat]
18:34-!-linville [~linville@sapphire.tuxdriver.com] has quit [Quit: Leaving]
18:36<Yaakov>I accept full responsibility.
18:36-!-jcn [~jcn@dsl027-145-028.nyc1.dsl.speakeasy.net] has joined #linode
18:38-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
18:38-!-BarkerJr [~BarkerJr@BarkerJr-2-pt.tunnel.tserv21.tor1.ipv6.he.net] has quit [Remote host closed the connection]
18:38-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
18:39-!-BarkerJr [~BarkerJr@2001:4b98:41::5cf3:88b:139] has joined #linode
18:40<amrnt>hat swap image is for?
18:40<amrnt>swap disk*
18:40<BarkerJr>it's used if you don't have enough ram to run everything
18:40<BarkerJr>it's "fake ram"
18:41<spkitty>how do you even have a computer and not know what swap is
18:41<BarkerJr>swap exists in windows and mac, too
18:41<@mikegrb>lolz
18:41<amrnt>lol
18:41<amrnt>i know
18:41<BarkerJr>hmm
18:41<amrnt>but just got with VPS things
18:41<BarkerJr>just set it to 256 and forget about it :)
18:41<spkitty>all the terms are the same
18:42<spkitty>all the rules are the same
18:42<BarkerJr>well, don't forget about it... using it too much kills performamce
18:42<spkitty>just think of it as a pretty basic computer with no graphics card but awesome network backbone
18:42<BarkerJr>there are rules?
18:42<spkitty>don't talk about fight club
18:43<opello>"what? you don't know how doped silicon transistors work? how can you even use a computer?!" :p
18:44<spkitty>swap space isn't exactly the same as the basics of transistors
18:44<opello>on some level it is
18:44<BarkerJr>they make transistors out ot silicone?
18:45<spkitty>wait
18:45<@mikegrb>lolz
18:45<BarkerJr>lol
18:45<spkitty>that's a very good point
18:45<opello>that's caulk :p
18:45<spkitty>how did i even miss that
18:46<spkitty>lint :v
18:46<opello>i spelled it elementally :p
18:46<opello>that must be the metal-oxide of mosfet :p
18:47<HoopyCat>the metal-oxide of mosfet is nothing but ground-up ashes from kittens
18:47<amrnt>this shiuld be amde by glass
18:47<Pryon>that's meowsfet
18:47<amrnt>ehhhhhhhhhh
18:47<opello>heh
18:47-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has joined #linode
18:47<sefz>hello
18:48<amrnt>hello
18:48<sefz>anyone hosting a lighttpd+fastcgi wordpress blog on linode here?
18:48-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
18:48<sefz>or lighttpd+fastcgi anyway
18:48<HoopyCat>sefz: lighttpd+fastcgi yes, wordpress not so much
18:48<sefz>HoopyCat: it's normal for you Requests per second: 4.29 [#/sec] (mean) ?
18:48<spkitty>wordpress yes, fastcgi no
18:49<spkitty>fuck fastcgi for wordpress
18:49<sefz>spkitty: what's your advice
18:49<spkitty>mod-php and apache is what i do sorry
18:49<Yaakov>I have a totally not Wordpress blog.
18:49<amrnt>apachi
18:49<sefz>apache is a ram-bitch :|
18:50<spkitty>true
18:50<spkitty>5% hit for each request :/
18:50<HoopyCat>sefz: no, i'm usually up closer to... (waiting for it to run)
18:50<Turl>lighttpd+php fcgi = my preferred stack
18:50<amrnt>so what to use? hhh
18:50<BarkerJr>y'know, I think the only reason people complain about apache using too much ram is cause they run huge CMS applications
18:50<sefz>Turl: do you have a wordpress blog running on it?
18:51<Turl>sefz: yep, why?
18:51<sefz>how many requests/s can you handle?
18:51<spkitty>BarkerJr: apache is a pretty big hit on my wordpress / rails 360
18:51<Turl>idk sefz, never stressed it
18:51-!-Guest1697 is now known as meff
18:51<sefz>what's the url?
18:52<sefz>can i do a test for you?
18:52<HoopyCat>oh i'm going in over the tunnel ain't i, that's why the openvpn gateway is burning my leg
18:52<sefz>just for learning purposes:P
18:52-!-meff is now known as Guest1702
18:53<amrnt>bye guys
18:53<amrnt>thanks for helping
18:53-!-amrnt [~d506d3ed@webuser.linode.com] has quit [Remote host closed the connection]
18:54-!-arooni-mobile [~arooni-mo@97-113-57-221.tukw.qwest.net] has joined #linode
18:55-!-borat [~wjesus@host223-107-dynamic.36-79-r.retail.telecomitalia.it] has quit [Ping timeout: 480 seconds]
18:56<Yaakov>I am going to have to stand up a VPN fro our new infrastructure. It might has as many as 300 users.
18:56<Yaakov>Actually, it might have more than that...
18:56<Yaakov>But I would guess no more than 50 concurrent.
18:56<BarkerJr>my VPS gets 300 hits a day
18:57-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
18:57<Yaakov>Hey, that's ALSO 300. I should use whatever you are using...
18:57<HoopyCat>sefz: i've seen a substantially high number with a properly-tuned not-wordpress blog via lighttpd and fastcgi. alas, i am having local network infrastructure issues doing such a benchmark right now.
18:57<spkitty>i sit around 50-70 hits a day, not much really
18:57<HoopyCat>sefz: suffice to say i can get enough traffic going to impact my local network! :-)
18:58<HoopyCat>oh there we go, i can run it from somewhere not on my local LAN
18:58<HoopyCat>Requests per second: 288.01 [#/sec] (mean)
18:58<Yaakov>I gather that OpenVPN is a likely choice for me.
18:59<sefz>omg!
18:59<HoopyCat>Yaakov: whatever you do, don't leave openvpn duties to an old dell PC you found sitting on the curb during a rainstorm!
19:00<HoopyCat>sefz: that's http://blog.hoopycat.com/, 50 concurrent requests, 1000 requests, no keepalives
19:00<spkitty>fuck, i just realised i get a wait of ~0-20 seconds when loading up my wordpress blog, but 0 seconds when loading up any other page
19:00<spkitty>i'm going to have to fix this
19:00<Yaakov>HoopyCat: It will be running on a VPS under Xen on a Sun X4100 dual core dual Opteron with 16GB of RAM.
19:01<rogi_>HoopyCat: how did you do that test?
19:01<HoopyCat>rogi_: ab -c 50 -n 1000 http://blog.hoopycat.com/
19:01<spkitty>http://superpositionkitty.com/ <-- do any of you guys have to wait to load this up
19:01<sefz>HoopyCat: what's your linode setup and which os are u using?
19:01<BarkerJr>HoopyCat: do you expect navive ipv6 to be slower than 6to4?
19:02<HoopyCat>spkitty: maybe a couple seconds of delay
19:02<rogi_>HoopyCat: Ok. Thanks.
19:02<spkitty>hmm, thanks HoopyCat
19:02<Yaakov>spkitty: It won't load here. I get 1 of 8 items and a stall.
19:02<spkitty>okay Yaakov that's just weird
19:02<HoopyCat>sefz: linode 360, lighttpd+fastcgi+php+xcache stock with ubuntu 8.04, b2evolution 3.3.1 (or whatever the most recent version was before the newest version was released)
19:03<Yaakov>This time, 8 seconds.
19:03<spkitty>ah
19:03-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Read error: Connection reset by peer]
19:03<spkitty>gonna have to turn keepalives off i think
19:03<HoopyCat>BarkerJr: i expect few things to be slower than 6to4
19:03<Yaakov>spkitty: Subsequent reloads are fast.
19:03<spkitty>Yaakov: should be, it's all cached
19:04<spkitty>maybe i should just set my cache to like a week instead of a day :v
19:04<Yaakov>~3 seconds, my link is slowish though.
19:04<spkitty>!newcalc 1 week in seconds
19:04-!-kenichi [~kenichi@199.223.126.66] has quit [Quit: kenichi]
19:04<linbot>spkitty: 1 week = 604 800 seconds
19:04<HoopyCat>spkitty: a week probably won't help much more than a day
19:04-!-hercynium [~hercynium@c-98-216-53-107.hsd1.ma.comcast.net] has joined #linode
19:04<spkitty>true :/
19:05<spkitty>do you guys reckon i should turn off keepalives then?
19:05-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
19:05-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit []
19:05<Yaakov>I did, it helped a lot t peaks.
19:05<Yaakov>But I am using Apache.
19:05-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
19:06<spkitty>i am too
19:06<HoopyCat>http://hennepin.hoopycat.com/munin/hoopycat.com/framboise-lighttpd_accesses.html
19:06*HoopyCat . o O ( i hope the graphs don't notice i just ab'd the crap out of myself )
19:07<HoopyCat>http://hennepin.hoopycat.com/munin/hoopycat.com/framboise-mysql_queries.html <--- and no, it's not all caching >:-)
19:08-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
19:08<spkitty>keepalives off ... that does actually seem quicker now
19:09<spkitty>your graphs just lost all sense of scale HoopyCat :P
19:10-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
19:10-!-arooni-mobile [~arooni-mo@97-113-57-221.tukw.qwest.net] has quit [Ping timeout: 480 seconds]
19:11<HoopyCat>spkitty: nod, that's why i don't run ab very often
19:12-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
19:13-!-DephNet[Paul] [~Paul@188-220-130-201.zone11.bethere.co.uk] has quit [Quit: Leaving]
19:14-!-Holstein [~BenC@modemcable168.131-83-70.mc.videotron.ca] has joined #linode
19:15<pwnguin>heh, you know, with all these git users posting suggested .gitignore stuff on their blog, im surprised nobody's started a .gitignore project
19:17-!-arthurb [~arthurb@office.rbery.bulletproof.net] has quit [Quit: Bye!]
19:17-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
19:23-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Quit: Leaving]
19:24-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
19:25-!-v0lksman [~shayne@ottawa-hs-64-26-169-151.s-ip.magma.ca] has joined #linode
19:25-!-Holstein [~BenC@modemcable168.131-83-70.mc.videotron.ca] has quit [Quit: Holstein]
19:25-!-hammockhero [~hammockhe@180.72.38.26] has joined #linode
19:31-!-jtaji [~jtaji@174.59.115.229] has joined #linode
19:40<Xel>Is the regular latest 2.6 kernel going to be getting any future upgrades? Or is the new default kernel going to switch to the paravirt kernel, which is much newer?
19:41<bob2>at some point
19:41<@caker>2.6.18 isn't going away any time soon, but soon all new deployments will be paravirt based <-- or something close to that :)
19:41-!-daMaestro|isBack [~jon@content.beatport.com] has joined #linode
19:41<Xel>caker, how is the performance difference between the two? Is there any reason that I should stick with 2.6.18?
19:42<@caker>no performance difference, that I'm aware of
19:42<Xel>So what's the actual difference then?
19:42<@caker>paravirt kernels require you to run ntp to keep good time
19:42<@caker>other than that, it's a newer kernel :)
19:42<Xel>Heh heh
19:42<Xel>So the non-paravirt kernel is going to stay at 2.6.18?
19:43<@caker>yes, blame xen on that one
19:43<Xel>Well I may as well bring my machine up to spee.
19:43<Xel>d
19:43<Xel>BRB :)
19:43-!-Xel [foobar@aurora.xelman.net] has quit [Quit: [BX] Save water -- drink beer!]
19:44-!-daMaestro [~jon@content.beatport.com] has quit [Ping timeout: 480 seconds]
19:45<Yaakov>Hello, caker.
19:46<@caker>howdy
19:46*HoopyCat refers to the data sheet for the 74LS112 J-K flip-flop
19:46-!-Xel [foobar@aurora.xelman.net] has joined #linode
19:46<Xel>Linux aurora 2.6.31.5-linode21 #1 SMP Mon Oct 26 18:17:01 UTC 2009 i686 GNU/Linux
19:46<Xel>wewt :)
19:46<bob2>good to see 74XXYYY still kicking
19:47<Xel>So I need to have NTP running? k.
19:47<HoopyCat>Xel: for a good time, fire up ntpd ;-)
19:47*HoopyCat 's been waiting all week for that double entendre
19:48<Xel>caker - does Linode maintain time servers at all? or do I just need to use some random public one?
19:48<HoopyCat>bob2: i usually use HCT, of course, but i do whatever the textbook tells me to do
19:48<HoopyCat>Xel: when in doubt, use 0/1/2/3.pool.ntp.org
19:48-!-Turl1 [~Turl@host199.190-137-200.telecom.net.ar] has joined #linode
19:48-!-Turl is now known as Guest1705
19:48-!-Turl1 is now known as Turl
19:49<@caker>HoopyCat: heh
19:49<@caker>Xel: no, we don't run any
19:49<Xel>Hoopy, the default install actually does: 0.debian.pool.ntp.org
19:49<Xel>I wonder if the debian.pool.etc matters
19:50-!-walterheck [~walterhec@124.157.181.121] has joined #linode
19:50<bob2>it is polite
19:50-!-bryen [~bryen@c-24-12-18-1.hsd1.il.comcast.net] has joined #linode
19:50-!-BarkerJr [~BarkerJr@2001:4b98:41::5cf3:88b:139] has quit [Remote host closed the connection]
19:50<HoopyCat>Xel: that'll work the same
19:51-!-Guest1705 [~Turl@host180.190-138-110.telecom.net.ar] has quit [Ping timeout: 480 seconds]
19:51-!-HedgeMage [~HedgeMage@c-67-186-107-186.hsd1.il.comcast.net] has quit [Quit: Real life calls.]
19:51-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
19:51<Xel>Well cool
19:51-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
19:51-!-Turl1 [~Turl@host71.190-137-35.telecom.net.ar] has joined #linode
19:51-!-Turl is now known as Guest1706
19:51-!-Turl1 is now known as Turl
19:52-!-Guest1702 is now known as meff
19:52<HoopyCat>Xel: ("debian" is an optional vendor code; if you're shipping things preconfigured to use pool.ntp.org, the head poologists drop a CNAME in. this can be steered elsewhere if something like the Great D-Link Disaster happens again)
19:53-!-meff is now known as Guest1707
19:54<bob2>if d-link actually use the hostname, though
19:54-!-seanscot [5c1db203@webchat.mibbit.com] has joined #linode
19:54<bob2>so it only helps for slightly polite vendors
19:54<seanscot>hi room
19:54<HoopyCat>bob2: yeah, that's kinda the problem with a lot of things, isn't it?
19:54<bob2>tis true
19:54<@mikegrb>lolz
19:54<seanscot>i just got totally banned from ubuntu room for no reason lol
19:55<seanscot>was a nice welcome "hello your banned u spammer" :S
19:55<bob2>well, talking like you're on AOL doesn't help
19:55<bob2>but take it up with them, not here
19:55-!-v0lksman [~shayne@ottawa-hs-64-26-169-151.s-ip.magma.ca] has quit [Quit: Ex-Chat]
19:55<@mikegrb>lolz
19:55<seanscot>lol how am i talking like im on AOL?
19:56<@mikegrb>lolz
19:56<bob2>er "lol"
19:56<bob2>"im"
19:56<bob2>"u"
19:56<bob2>etc
19:56<seanscot>uff
19:56-!-arooni-mobile [~arooni-mo@97-113-57-221.tukw.qwest.net] has joined #linode
19:56<seanscot>I am sincerley sorry sir.
19:56-!-Guest1706 [~Turl@host199.190-137-200.telecom.net.ar] has quit [Ping timeout: 480 seconds]
19:57<seanscot>I will try and be in the category of 0.001% who actually use proper oxford english when chatting online.
19:57<bob2>hooray
19:57<seanscot>Laughs out loud.
19:58<seanscot>I did'nt even talk though , just got kicked immediatley
19:58-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
19:58-!-RSully [~RSully@pool-74-97-182-218.prvdri.fios.verizon.net] has quit [Ping timeout: 480 seconds]
19:58<seanscot>anyways
19:58<tonyyarusso>seanscot: If you want to so that, it's "try to", not "try and".
19:58<seanscot>hahaha
19:58<@mikegrb>lolz
19:58<seanscot>now you're taking the piss lol
19:59<seanscot>I really hope none of you guys are American who are correcting me because the USA is the country that officially bastardises the English language
20:00<@mikegrb>lolz
20:00<seanscot>And if you are I hope you recognise that fact lol
20:00<Battousai>you mean bastardizes
20:00<HoopyCat>bastardices
20:00<seanscot>no that is american english
20:01<seanscot>bastardise is English
20:01<Battousai>american english is correct english
20:01<seanscot>its not , its retard English
20:01<@mikegrb>lolz
20:01<seanscot>lol
20:01-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
20:01<rsdehart>you for got to lol
20:01<rsdehart>gah
20:02<rsdehart>forgot.
20:02<seanscot>lol
20:02<amitz>lol
20:03<seanscot>but it is the dominant culture
20:03<seanscot>which is why i find myself resembling american english in chat rooms
20:03<amitz>seanscot: depends on which part of the world you're in.
20:04<seanscot>yeah , well im fully willing to accept that the english language is changing , for better or worse its changing
20:04<seanscot>which is why you cant really have too many hangups with "correctness" anymore
20:04<@mikegrb>lolz
20:04<seanscot>lol
20:05<seanscot>doesnt bother me really , only bothers me when i try to put in a command in english and it doesnt work
20:05<seanscot>because I then realise it was the retarded american version of the word
20:06-!-jcn [~jcn@dsl027-145-028.nyc1.dsl.speakeasy.net] has quit [Ping timeout: 480 seconds]
20:06<seanscot>wants*
20:06-!-dajhorn [~chatzilla@user-0cet72i.cable.mindspring.com] has quit [Ping timeout: 480 seconds]
20:08<SelfishMan>!urmom <redacted>
20:08<linbot>SelfishMan: timed out
20:09<SelfishMan>wha?!
20:09<SelfishMan>!urmom <redacted>
20:09<linbot>SelfishMan: Yo momma's so dumb, she can't spell a. (730:7/5) [ummro]
20:10<Yaakov>There is nothing sub-standard about standard American English. It is not only silly but rude to prattle on about its inferiority. In fact, in many cases American English has evolved were British English has not. So please try to keep the vacuous codswallop to a minimum.
20:10<JshWright>s/were/where/
20:11<Battousai>whatuous whathwat
20:11<Trystan>there is nothing sub standard about it, But I do not consider it CORRECT english myself
20:11<Yaakov>Yes, it needs an h.
20:11<Trystan>I consider it 'American English'
20:11<Trystan>with English being that spoken/written in England :)
20:12<Yaakov>Trystan: That's very priggish, but meaningless.
20:12<@mikegrb>lolz
20:12<seanscot>lol
20:13<seanscot>well studies suggest that the average american uses much less words than the average brit
20:13-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has quit [Ping timeout: 480 seconds]
20:13<Yaakov>Fewer would be a much better word choice.
20:13<Trystan>not really. It is acknowledging a difference between them without trying saying one is better than the other or one is correct
20:13<X-LP>true.
20:13-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Read error: Connection reset by peer]
20:13<seanscot>not at all yaakov , cos theres tons of words in english that have slightly different meanings that americans miss out on
20:14<Yaakov>No, "British English" would make that distinction.
20:14<Pryon>"bastardise"? What would the OED have to say about that ending? Shame, shame!
20:14<Yaakov>seanscot: Things which have NUMBER are fewer, things which have MAGNITUDE are less.
20:14<seanscot>"English" is the language
20:14<Yaakov>seanscot: You used the wrong word..
20:14<Trystan>there is no point in putting the prefix on British, since it is based from England imho
20:15<Trystan>hence, english
20:15<@mikegrb>lolz
20:15<seanscot>uff , seems like Yaakov is on a campaign to undermine my personal use of the English language. lol
20:15<seanscot>exactly trystan
20:15<Yaakov>English is spoken in many places. In spite of the admirable nationalistic spirit, "British English" is not "unqualified English".
20:16<seanscot>even the term "American English" or "Jamaican English" i find quite silly at times
20:16<Trystan>I am actually Australian
20:16<Trystan>and we have Australian English as a variety so don't say i am doing this as 'nationalistic spirit'
20:16<seanscot>yeah , but , when you cut the crap. its all English , and its from England
20:16<Yaakov>Trystan: You apparently don't know the history of the English language or how languages evolve.
20:16<seanscot>im not nationalistic about it because im Scottish
20:17<Trystan>apparently not.
20:17<seanscot>and I hate the fact its been thrust upon us and our native gaelic trampled on , but a spade is a spade
20:17-!-Keith [fluffy-kit@c-75-70-191-0.hsd1.co.comcast.net] has quit [Quit: Freedom Chat - Your Home Away From Home | http://www.freedomchat.org | tIRC script by the Freedom Chat Leets]
20:17<Yaakov>No, it is not. English is a language which is very dependent on loan words. "English" from England is a primitive component, based on Anglo-Saxon words generally considered the least sophisiticated.
20:18<JshWright>seanscot: not for nothing, but your use of that expression is another example of a lack of understanding of etymology
20:18<Yaakov>Most educated speakers, particularly in England, use latinate forms and loan words which are very recent introductions.
20:18<seanscot>thats nonsense yaakov , Oxford english is the most sophisticated western language there is
20:18<seanscot>i agree yaakov
20:19<Trystan>I agree with him seanscot it IS taken from anglo-saxon and other languages
20:19<seanscot>i constantly americanise my chatting online . i was chastised for it when i entered this room infact
20:19<Trystan>but that doesnt change the fact that it was derived as its own language in England
20:19<seanscot>yeah i agree
20:19<HoopyCat>no, you were chastised for calling it a room :-)
20:19<JshWright>seanscot: and using abbreviations like "u"
20:19<@mikegrb>lolz
20:19<HoopyCat>WHEN WE MOCK U, PLZ BE AWARE OF THAT WHICH WE MOCK LOL
20:19<@mikegrb>lolz
20:19<amitz>and lol :-p
20:19<JshWright>which is hardly "american"
20:20<seanscot>yeah , exactly , and i just pointed out that its in the same spirit as american english "colour" "color" etc
20:20<HoopyCat>oops, hit the cats lock key
20:20-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
20:20<seanscot>same principle
20:20<seanscot>its all for convenience
20:20<seanscot>and it doesnt matter jackshit really
20:20<seanscot>but when it compromises skills of articulation then its not good
20:21<Yaakov>Speakers at Oxbridge are a TINY minority of British Speakers. You seem to be advocating for the British equivalent of the Académie Française.
20:21<seanscot>no , but even some words when i talk to americans they are like "uhh i dunno what that means" theres a pattern of it
20:21<amitz>seanscot: I think abbreviations is basically being nice to yourself instead of others.
20:21<Yaakov>There is no prescriptive English, and the average British speaker is no expert in the language.
20:21<@mikegrb>lolz
20:21<seanscot>and im like "how can you survive without that world" lol
20:22<seanscot>yaakov , that is nonsense
20:22<seanscot>prescriptive English is Oxford English
20:22<Yaakov>Brilliant argument. I concede.
20:23<seanscot>its the authoritive written dictionary if there is one
20:23<HoopyCat>seanscot: my pocket dictionary has ~70,000 words in it, and danged if i have to reference it regularly in my readings. most people don't have a pocket dictionary.
20:23-!-memenode [~daniel@230-129.dsl.iskon.hr] has quit [Remote host closed the connection]
20:23<JshWright>I has a google
20:23<HoopyCat>this sucker hasn't failed me yet, though.
20:23<@mikegrb>lolz
20:23<seanscot>i know , im actually starting to realise that there is a good point in what everyone is saying here lol
20:24<@mikegrb>lolz
20:24<opello>lol, 'authoritative' english :)
20:24<opello>there is no such thing
20:24<seanscot>I suppose its not american english as such thats the problem , but more that there is clear education problems in the USA , of which no one here seems to be afflicted with lol
20:24<litwol|mac>!urmom
20:24<linbot>litwol|mac: Yo momma's so stupid, she managed to MySQL inject an HTML form with no action property. (770:1/5) [mroum]
20:24<litwol|mac>That makes no sense at all
20:24-!-Holstein [~BenC@modemcable168.131-83-70.mc.videotron.ca] has joined #linode
20:25<litwol|mac>!help
20:25<linbot>litwol|mac: (help [<plugin>] [<command>]) -- This command gives a useful description of what <command> does. <plugin> is only necessary if the command is in more than one plugin.
20:25<litwol|mac>!help urmom
20:25<linbot>litwol|mac: (urmom <an alias, 0 arguments>) -- Alias for "web title http://urmom.selfishman.net/?s=linbot&u=$nick&q=@1".
20:25<litwol|mac>!urmom help
20:25<linbot>litwol|mac: urmom usage: urmom [regex] [in (pig latin | russian | italian | albanian | swedish | greek | spanish | french | hebrew | arabic | german)]. Note: '/ /' on the regex is implied. Follow urmombot on twitter for realtime updates of the jokes! litwol|mac's mom, however, is beyond help. [murom]
20:25<seanscot>wtf
20:25<@mikegrb>lolz
20:25<seanscot>lol
20:25<Yaakov>I speak standard American English and the expressive power of my language is not a second to British English, spoken at Oxbridge or anywhere else. And, for the record, the Oxford Dictionary of the English Language is the premier example of a *descriptive* dictionary, not a prescriptive one. In English, prescriptive dictionaries are laughed at.
20:26<HoopyCat>as a writer, you have to write for your audience. if your audience doesn't know their verisimilitude from vertiginous, you should probably revise it back a little bit.
20:26<opello>they call that rhetorical sensitivity in english class :p
20:26*litwol|mac googles those words
20:26<seanscot>yeah , shame that active dumbing down of the population could mean that we will all have to talk like retards to be understood
20:27<litwol|mac>THat's always been the case and will always be the case
20:27<seanscot>the active dumbing down in American culture is there for all to see , its becoming more prevelant in every country though.
20:28<litwol|mac>While general population intelligence rise, there are selective groups that will rise even further. and then they start complaining that they require to dumb down their speech to be understood ;)
20:28<seanscot>loss in articulation is a sad state
20:28<opello>the culture in general? i don't think things are dumbed down to such a degree as that suggests
20:28<@mikegrb>lolz
20:28<rsdehart>"...lol"
20:28<@jed>we're hackers, guys: http://www.youtube.com/watch?v=O2rGTXHvPCQ
20:28<seanscot>sorry , il rephrase , "popular culture"
20:29<HoopyCat>seanscot: moar words == less comprehension. name of the game. that's why fire alarms don't annunciate with urgency their request to vacate via the nearest egress with great dispatch; that's why they say "LEAVE THE BUILDING THROUGH THE NEAREST EXIT" in between loud squawking sounds. we gotta work with what we got.
20:29<opello>4n|) \/\/|= 0/\/|_y |_|s3 one-three-three-seven speak :p
20:29<JshWright>seanscot: Perhaps this is another Real/Fake English distinction, but 'round these parts, 'retard' is considered a fairly insensitive pejorative
20:29*litwol|mac lols @ jed
20:29<@mikegrb>lolz
20:29<seanscot>it is insensitive , but i dont claim to be sensitive lol
20:29<opello>jed: but at least they got '6667' and '#' right :p
20:30<Yaakov>The estimated average IQ in England is 100, in the US it is 98. Wow, you are smart.
20:30<seanscot>what is it in Scotland?
20:30<seanscot>above England I would imagine :P
20:30-!-Guspaz [~gus@206-248-152-162.dsl.teksavvy.com] has joined #linode
20:30<seanscot>since we invited just about everything worthwhile
20:31<seanscot>lolol
20:31<seanscot>invented*
20:31<Yaakov>It is actually folded into Great Britain at 100.
20:31<seanscot>didnt sound too smart there did I? lol
20:31<HoopyCat>it's a bit of a false comparison; it's already been established that all outside of scotland is comperable to crap
20:31<seanscot>ahh , thats not fair yaakov , thats like saying "oceania" for austrailians
20:31<@mikegrb>lolz
20:31<seanscot>lol hoopy
20:32<Yaakov>There have been several exceptional mathematicians from Scotland. Actually, an unusual number.
20:32<seanscot>and inventors
20:32<JshWright>did they talk good english?
20:32<seanscot>my parents are Irish though ,thats why im thick lol
20:33<JshWright>seanscot: a few of my favorite books were written by an Irishman
20:33<Yaakov>All the data is "Great Britain", no separate Scotland.
20:33<JshWright>well, an Irishman born in the US, but raised in Ireland
20:33<HoopyCat>and by "books" he means "boozes", and by "written" he means "stolen", and by "an" he means "some drunk"
20:34<@mikegrb>lolz
20:34<seanscot>lol
20:34<amitz>I only know scotland form highlander :-p
20:34<JshWright>he
20:34<amitz>*from
20:34<JshWright>s/$/h/
20:34<Trystan>Braveheart?
20:34<Yaakov>Scots are nearly impossible to understand, particularly when they get agitated. But you can get the gist of whether your life is in danger, usually.
20:34<JshWright>FREEEEEEEEEEEDOM!
20:34<seanscot>yeah but scotland is quite different to england
20:34<Trystan>it all depends on exposure I think
20:34<seanscot>and GB figures obscure Scottish figures , as we are 5 and a half million and they are 50 million
20:35<Trystan>I can understand some scottish accents fine because I grew up with one
20:35<seanscot>really? where from trystan?
20:35<Trystan>glasgow area I think
20:36<amitz>oh yeah, and bravehear.
20:36<dioz>omg i'm down
20:36<@mikegrb>lolz
20:36<seanscot>lol
20:36<dioz>o nvm
20:36<Yaakov>All of the great Scots scientists shared a particular attribute: a distaste for whisky.
20:36<seanscot>right cool , im from Glasgow
20:36<dioz>it's back up now
20:36<HoopyCat>i get knocked down, but i get up again
20:36<Trystan>one thing I cannot understand though, Is newcastle 'Chav' slang!
20:37<seanscot>newcastle folk are all chavs
20:37<seanscot>scumbags
20:37<JshWright>s/down(.*)up/up$1down/
20:37<seanscot>lol
20:37<seanscot>not as bad as the liverpudlians or "scousers"
20:37-!-JBzh [Bzh@bre29-1-82-245-185-109.fbx.proxad.net] has quit [Quit: reboot]
20:37<Yaakov>Come now, they are some of those lovely Brits! Much more articulate than we upstart colonists.
20:37<seanscot>they are scum on a different level
20:38<@mikegrb>lolz
20:38<seanscot>they arent , they are arse-ends . its the finely educated south english who are much more articulate than you upstart colonists. lol
20:38-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Read error: Connection reset by peer]
20:38-!-dajhorn [~chatzilla@user-0cet72i.cable.mindspring.com] has joined #linode
20:39-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
20:39<seanscot>dont get me started on Australia though , cos I feckin love Aussies :P
20:39<Yaakov>According to this data, the average IQ in Iran is 84.
20:39-!-Turl [~Turl@host71.190-137-35.telecom.net.ar] has quit [Quit: Leaving.]
20:39<spkitty>wait what
20:39<spkitty>what is with scotland chat
20:39<@mikegrb>lolz
20:39<seanscot>lol
20:39<spkitty>i am not even here
20:40<seanscot>what site is that yaakov?
20:40<Yaakov>http://www.rlynn.co.uk/pages/article_intelligence/t4.asp
20:40<spkitty>also you can't say scots are hard to understand until you've heard an angry dundonian
20:40<seanscot>because , in roughly 15 minutes u will be transported to scotland
20:40-!-dale [~dale@li3-65.members.linode.com] has joined #linode
20:40<seanscot>lol kitty
20:40<seanscot>i dont understand shit that they say
20:41*spkitty lives in dundee
20:41*spkitty is an australian
20:41-!-Sean [~4374f014@webuser.linode.com] has joined #linode
20:41<Yaakov>spkitty: Well now, I never said Scots were the worst, but, that doesn't change the fact that an angry Scot doesn't speak English, even if he thinks that's what he's doing.
20:41<Sean>Hey how could i VNC onto my linode from my mac?
20:41<seanscot>cool :)
20:41<spkitty>Yaakov: more to the point all great scottish scientists shared one particular attribute - they got the fuck out of scotland as soon as they could
20:41<seanscot>well scots still speak a lot of scots
20:42<spkitty>no they don't
20:42<seanscot>which is technically a different language
20:42<spkitty>scots as a real language isn't ever spoken these days
20:42<spkitty>they speak some mishmash of scots and english
20:42<seanscot>parts of it are kitty
20:42<Yaakov>I have Welsh friends, they have the best langauge.
20:42<seanscot>yeah exactly
20:42<Sean>pk wild
20:42<Sean>** How can i VNC onto my linode from my mac
20:42<seanscot>nah , Irish gaelic is the best language
20:43<HoopyCat>Sean: in theory, you could. might not be the world's best idea. what do you want to do?
20:43-!-laser` [~laser@dyn245212.shef.ac.uk] has quit [Remote host closed the connection]
20:43<Yaakov>Sean: You'd have to run a very heavy X/VNC server.
20:43<seanscot>what u doin up in that drech place kitty?
20:43<spkitty>seanscot: moved here to live with my girlfriend
20:44<Sean>ok so basically i want to start a process, but i dont want it to stop if MY terminal closes
20:44<seanscot>cool
20:44<spkitty>we're likely moving out of dundee at the end of the year anyway - probably into the country up north somewhere
20:44<seanscot>interesting
20:44<HoopyCat>Sean: take a look at "screen"
20:44<seanscot>its nice up north
20:44<Sean>however i dont want to nohup, because it creates a nohup.out file
20:44<seanscot>but i do like glasgow city life
20:44<spkitty>i hate glasgow sorry to say
20:45<spkitty>it's like dundee but slightly bigger
20:45<seanscot>have u spent much time here ?
20:45<Sean>Is there a way i can start a process from my computer without creating an output in a file?
20:45<spkitty>fuck the metal community that makes up both towns
20:45<spkitty>seanscot: i've been down a few times
20:45<Yaakov>I am sorry, but even though I love my Irish friends, they don't have a town called Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.
20:45<seanscot>metal community is crap .
20:45<@mikegrb>lolz
20:45<seanscot>lol yaakov
20:45<HoopyCat>Sean: take a look at "screen"
20:46<seanscot>hmm , uve been to the wrong places and in the wrong company then kitty
20:46<seanscot>Glasgow is nothing like Dundee , unless u went to the shitholes
20:46-!-SNy [0eb7ddbe1a@bmx-chemnitz.de] has quit [Ping timeout: 480 seconds]
20:46<JshWright>Sean: sure, why not?
20:46<Sean>where can i find "screen"?
20:46<JshWright>Sean: apt-get install screen
20:46<spkitty>seanscot: i could say the same about dundee, it's really not just a shithole
20:46<Yaakov>That's a real Welsh town.
20:47<Sean>then what?
20:47<spkitty>also my favourite part about Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is how it breaks all websites that try to display it's name
20:47<JshWright>run "screen"
20:47<seanscot>yeah , but even an honest dundonian that knows anything about music or culture would admit that Glasgow is the place to be in scotland
20:47<spkitty>hahah
20:47<seanscot>dundee is a town compared to glasgow
20:47<spkitty>i much prefer eds personally
20:47<HoopyCat>Sean: http://www.debian-administration.org/articles/34
20:47<spkitty>duh, dundee is such a town
20:47<spkitty>glasgow is a town compared to most places i've lived too though
20:47<Yaakov>But there is a Thai town called Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.
20:48<seanscot>eds looks nice , but like dundee its a bit small and lacking in music culture
20:48<HoopyCat>Sean: that runs you through the basics
20:48<Yaakov>However, that's a transliteration so I don't know how long it is in the Thai orthography.
20:48<Sean>thanks
20:48<seanscot>maybe , but if u ever wanna come down il take u around
20:48<Sean>ok ive installed it
20:48<seanscot>and im confident u would change your mind on glasgow
20:48<seanscot>you need to know where to go to to get the most out of glasgow
20:48<seanscot>theres different ends to the city
20:49<Sean>how would i run screen?
20:49<JshWright>Sean, type "screen" and press enter
20:49<Sean>thanks
20:50<spkitty>may take that up on you one day seanscot - but i'm off for now
20:50<seanscot>righty o mate
20:50<seanscot>take care
20:51<HoopyCat>jesus christ it's a car get in the lion
20:52<seanscot>btw , im a total linux virgin
20:52<seanscot>im totally excited about losing it to ubuntu
20:52<aspect>Yaakov: "a Thai town" .. you mean Bangkok? :-)
20:53<JshWright>seanscot: good choice, it'll be gentle with you
20:53<Sean>Wow you guys have helped me out so much thank you a million times
20:53<@mikegrb>lolz
20:53<seanscot>lol jsh
20:53<seanscot>how did the conversation change to ladyboys??
20:53-!-Guest1707 is now known as meff
20:53<seanscot>or is that just my dirty mind when i heard "bangkok" ?
20:53<@mikegrb>lolz
20:53<seanscot>lol!!
20:54-!-meff is now known as Guest1713
20:54<seanscot>is it going to be a hassle to connect mobile broadband with ubuntu ?
20:55-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
20:57-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
20:57<Bdragon>I totally can't avoid smirking when I see the word Bangkok.
20:58-!-arooni-mobile [~arooni-mo@97-113-57-221.tukw.qwest.net] has quit [Ping timeout: 480 seconds]
20:58<@mikegrb>lolz
20:58<seanscot>lol
20:58<aspect>how about Phuket?
20:58<seanscot>hahaha
20:59<seanscot>a pretty ladyboy, would u phuket?
20:59<@mikegrb>lolz
20:59<seanscot>loL!
20:59<seanscot>mike , u dont say much other then lolz
20:59<@mikegrb>lolz
20:59<seanscot>lol
20:59<seanscot>lolzzer
21:00<Bdragon>What's a ladyboy? Actually, scratch that, I'd rather not know.
21:00-!-Holstein_ [~BenC@mirage.turbulent.ca] has joined #linode
21:00<seanscot>yeah, u dont want to know bdragon
21:00<seanscot>cos its damn confusing
21:00<@mikegrb>lolz
21:00<seanscot>lol
21:02<sefz>i have bought a linode vps today, i want to point my old site to my new linode ip
21:02<sefz>it's everything done thru the DNS Manager?
21:02<sefz>i set the ns1.linode.com ns1.linode.com etc to my old server
21:03<seanscot>many ladyboys look just like women , and its only after u get them to the hotel u might be in for a big surprise when you go for the old 'reacharound'
21:03<seanscot>lolol
21:03<Bdragon>seanscot: Is this what the song "Lola" is all about? :P
21:03<seanscot>not sure mate
21:03<seanscot>what song is that?
21:04<Bdragon>I'd hum a few bars but I don't know how to type that :P
21:04<seanscot>whatever lola wants , lola gets?
21:04<Bdragon>no, the other one
21:04<Bdragon>tastes just like cherry cola
21:04<Bdragon>la la la la lola
21:04<seanscot>lola by the kinks?
21:05<Bdragon>Ringing a slight bell. I've never been one for remembering my artists (and only slightly better at titles tbh)
21:05<linbot>New news from forums: Issues while executing commands with the php shell script in Linux, Apache, Mysql and PHP (LAMP) Forum <http://www.linode.com/forums/viewtopic.php?t=4829>
21:05<seanscot>yeah , its the kinks
21:05<@mikegrb>lolz
21:05<seanscot>lol
21:05<seanscot>i had a lucky escape in norway
21:06<seanscot>i nearly got it on with a filipino girl i met in a club
21:06<Bdragon>sefz: You aren't *required* to host dns at linode, but if you do want to, you can do it through the manager, yeah.
21:06<seanscot>just to get back to her apartment and tell me that she has a tool
21:06<@mikegrb>lolz
21:06<seanscot>lol!
21:06-!-Holstein [~BenC@modemcable168.131-83-70.mc.videotron.ca] has quit [Ping timeout: 480 seconds]
21:06-!-Holstein_ is now known as Holstein
21:06<sefz>Bdragon: and what I have to do on the other side? I've only pointed DNS to linode (ns1. ns2. ns3. and ns4)
21:06<Bdragon>Alternatively you can run your own dns server on the linode and slave linode's dns servers to it, if you like editing your zones by hand or something :P
21:07<sefz>but it seems to not reverse
21:07<Bdragon>sefz: Reverse dns? That's done through the network tab
21:07<sefz>No match was found for "filmpertutti.com". Reverse DNS must have a matching forward entry for one of your IPs.
21:07<Bdragon>It will attempt to resolve it and make sure it matches before letting you use it
21:08<Bdragon>so if you changed the nameservers for your domain to linode then you'll have to add an A record in the dns manager first
21:08-!-Sean [~4374f014@webuser.linode.com] has left #linode []
21:08<Bdragon>Gotta take care of the forward dns before it will let you take care of the reverse dns.
21:08<Bdragon>(It's to prevent people from setting their rdns to something they don't own)
21:11<bob2>if you just asked it to try, you might have to wait up to 24 hours to try again
21:11<sefz>can you paste to me your /dns filmpertutti.com ?
21:11<sefz>guys?
21:11<bob2>!dns filmpertutti.com
21:11<linbot>bob2: 74.81.65.167
21:11<bob2>sefz: 15 minute delay man
21:11<sefz>that's the old one
21:12<bob2>well, you can run 'dig filmpertutti.com @ns1.linode.com', too
21:12<sefz>root@li109-134:/etc# nslookup filmpertutti.com
21:12<sefz>Server: 72.14.179.5
21:12<sefz>Address: 72.14.179.5#53
21:12<sefz>Non-authoritative answer:
21:12<sefz>Name: filmpertutti.com
21:12<sefz>Address: 69.164.194.134
21:13<sefz>here's old ip and Linode ip (on non-authoritative answer?!)
21:13<bob2>so
21:13<bob2>don't run that
21:13<bob2>run the command I have you
21:13<bob2>er gave
21:13<sefz>;; ANSWER SECTION:
21:13<sefz>filmpertutti.com. 86400 IN A 69.164.194.134
21:15<sefz>so what's up ?:(
21:15-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has joined #linode
21:15-!-walterheck [~walterhec@124.157.181.121] has quit [Ping timeout: 480 seconds]
21:16<bob2>what do you mean?
21:17<bob2>I assume you tried to do this within 15 minutes of making a change in the dns manager
21:17<bob2>right?
21:17<sefz>yep
21:17<Bdragon>;; ANSWER SECTION:
21:17<Bdragon>filmpertutti.com. 86399 IN A 69.164.194.134
21:17<Bdragon>for me the authority is linode nameservers
21:17<Bdragon>is 69.164.194.134 your linode ip?
21:17<sefz>so? it's only propagation time issues?
21:18<sefz>yes
21:18<bob2>so now you have to wait up to 24 hours
21:18<sefz>ok.
21:18<bob2>for the value to fall out of the cache
21:18<Bdragon>Why not try setting rdns again?
21:18<bob2>though, I think they might have added special support for the linode nameservers
21:18<sefz>because it says to me again No match was found for "filmpertutti.com". Reverse DNS must have a matching forward entry for one of your IPs.
21:19<Bdragon>I would imagine the rdns checker would bust the cache
21:19<Bdragon>to get fresher info
21:19<bob2>at least in the past, it did not
21:19<Bdragon>That kinda sucks then, heh
21:21<Bdragon>;; ANSWER SECTION:
21:21<Bdragon>filmpertutti.com. 86398 IN SOA ns1.linode.com. seffignoz.gmail.com. 2009111185 7200 7200 1209600 86400
21:21<Bdragon>Try again in 2 hours?
21:21<sefz>i home not to fall asleep:) it's 3:22 here
21:22*Bdragon discovers the +multiline option
21:22<linbot>New news from forums: Domain not working without 'www' infront of name in Linux Networking <http://www.linode.com/forums/viewtopic.php?t=4824>
21:22<sefz>!dns filmpertutti.com
21:22<linbot>sefz: 74.81.65.167
21:22<Bdragon>Yay, I don't have to remember the format of an SOA record in my head anymore :P
21:23-!-Holstein_ [~BenC@modemcable168.131-83-70.mc.videotron.ca] has joined #linode
21:23<orudie_>google just increased storage to paid customers 4 times - from 20 gb to 80
21:24-!-armbruster [~armbruste@h-96-13-22-50.ip.alltel.net] has joined #linode
21:24<orudie_>just got email from them
21:24-!-Holstein_ [~BenC@modemcable168.131-83-70.mc.videotron.ca] has quit []
21:28<JoeK>!dns google.com
21:28<linbot>JoeK: 74.125.45.100
21:28<JoeK>hm, dosent show round robins
21:28<JoeK>:(
21:29<MJCS>http://www.net-security.org/secworld.php?id=8489 hahahaha IE is more secure than firefox
21:30-!-Holstein [~BenC@mirage.turbulent.ca] has quit [Ping timeout: 480 seconds]
21:30<sefz>!dns filmpertutti.com
21:30<linbot>sefz: 74.81.65.167
21:30<sefz>@#!£$"£&
21:30-!-walterheck [~walterhec@124.157.177.43] has joined #linode
21:38-!-Hareem-Haque [~chatzilla@bas1-toronto29-1279397658.dsl.bell.ca] has quit [Quit: ChatZilla 0.9.85 [Firefox 3.5.5/20091102152451]]
21:41-!-walterheck is now known as Guest1715
21:41-!-walterheck_ [~walterhec@124.157.177.43] has joined #linode
21:41-!-Guest1715 [~walterhec@124.157.177.43] has quit [Read error: Connection reset by peer]
21:41-!-walterheck_ is now known as walterheck
21:42-!-armbruster [~armbruste@h-96-13-22-50.ip.alltel.net] has quit [Ping timeout: 480 seconds]
21:42<HoopyCat>the cache will clear out tomorrow, bet your bottom dollar that tomorrow, they'll refresh
21:42*amitz bets his linode
21:42<HoopyCat>just thinkin' about tomorrow, doesn't clear them, or fix it, for the 'net
21:42<amitz>bets for the winner.
21:43<HoopyCat>when i'm stuck in a cache that's long and sticky, i just stick out my chin, and grin, and say.... oh!
21:44<HoopyCat>the cache will clear out tomorrow, so you gotta hang on 'til tomorrow, come what may! tomorrow! tomorrow! i loathe you, tomorrow! you're always 86400 seconds awaaaaaayyyyyyyyyy
21:44<amitz>luckily there is no forever cache...or there is?
21:45*amitz plays the guitar
21:45*HoopyCat sends a check for $0.03 and an apology letter to Martin Charnin
21:46<amitz>oh wait, that's a reference to a rule IIRC.
21:46-!-sno [~sno@secksi.net] has joined #linode
21:48*HoopyCat . o O ( "what's up?" "airplanes, formations of geese, and the pop culture references flying over amitz's head" )
21:48<HoopyCat>amitz: http://en.wikipedia.org/wiki/Tomorrow_%281977_song%29 and http://en.wikipedia.org/wiki/Martin_Charnin
21:49-!-Holstein [~BenC@modemcable168.131-83-70.mc.videotron.ca] has joined #linode
21:49<sefz>Do you want to use filmpertutti.com as the reverse DNS entry for 69.164.194.134?
21:49-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
21:49<sefz>yesh!!!!!
21:49-!-jtaji [~jtaji@174.59.115.229] has quit [Remote host closed the connection]
21:49<sefz>!dns filmpertutti.com
21:49<HoopyCat>REPRISE!
21:49<linbot>sefz: 69.164.194.134
21:49<sefz>zomg!
21:50-!-cb [~cbrevard@ip24-251-236-201.ph.ph.cox.net] has joined #linode
21:50<cb>hello
21:50-!-cb is now known as Guest1716
21:50-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Read error: Connection reset by peer]
21:50-!-Guest1716 is now known as chb
21:50<amitz>HoopyCat: oh, I already gave up understanding reference to pop culture, I always suck at them, even the local ones. I'm talking about the 0.03cents thingie.
21:51<chb>I've a question re: partitioning
21:51<amitz>ask awachb
21:51<Bdragon>sefz: Gratz
21:51<amitz>ask away chb
21:51<chb>cool, thx
21:52<chb>so, I've followed the instructions provided here: http://www.linode.com/forums/viewtopic.php?t=4748&highlight=unknown+partition+table
21:52-!-Holstein [~BenC@modemcable168.131-83-70.mc.videotron.ca] has quit []
21:52<chb>and I keep getting erros like "Uknown partition table"
21:52<chb>and blkfront barrier something
21:53<chb>and the instance is unresponsive when i try ssh/lish
21:53<chb>I'm tring this with Debian 9.10 and the newest kernel
21:54<sefz>i'm really happy with linode dudes...
21:54<@caker>unknown partition table is totally normal -- there is no partition!
21:54-!-Guest1713 is now known as meff
21:54<sefz>it's very fast and cheap..
21:54<bob2>caker: does the forward-dns check in the rdns thing special case the linode nameservers?
21:54-!-tar_ [~tom@c-67-180-208-162.hsd1.ca.comcast.net] has joined #linode
21:55<amitz>I think you can abuse an institution by sending them something when they're required to do something for each thing you send. But I forget the specific..
21:55<@caker>bob2: no
21:55<chb>yeah, normally I'd agree with you, but I've created both the mount points and the disk images
21:55-!-meff is now known as Guest1717
21:55<chb>and have edited fstab accordingly
21:55-!-tar_ [~tom@c-67-180-208-162.hsd1.ca.comcast.net] has left #linode []
21:56<@caker>chb: what you've done is create virtual disk devices. There are still no partitions on those virtual disks
21:56<@caker>so you can ignore the "unknown partition table"
21:57<bob2>caker: ah, thanks
21:57<chb>so, you're saying that this is a red herring and not, in fact, the reason why the system is unresponsive?
21:57<@caker>correct, and I don't know
21:58<@caker>sorry -- read that wrong. Correct answer is: affirmative
21:58<encode>http://www.webmonkey.com/blog/Meet_Go__Google_s_New_Programming_Language <-- nifty
21:58<chb>caker: np, and thanks
21:58-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
21:58-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
21:59<HoopyCat>amitz: i figure $0.01 per 100 people in this channel for royalties
21:59<chesty>goo, the next generation google programming language
21:59-!-daMaestro|isBack [~jon@content.beatport.com] has quit [Quit: Leaving]
22:00<@caker>chb: did you lob the data from the source directories onto the new devices?
22:03<amitz>HoopyCat: ah
22:03<seanscot>whos using ubuntu in here then?
22:03*amitz still unsure about the meaning of ah, eh, hehe, haha, hoho, harhar, and many more...
22:04-!-Dreamr_3 [~Dreamer3@96-28-100-3.dhcp.insightbb.com] has quit [Quit: This computer has gone to sleep]
22:04<HoopyCat>if i'm not wearing a jacket, it is acceptable to attach a lapel pin in the middle of the tie, right?
22:04<HoopyCat>last hell-day prep mystery remaining before i go to bed
22:04<amitz>what to google to learn more. Meaning of exclamation doesn't return expected results.
22:04<HoopyCat>amitz: it's more of a sound thing
22:04<chb>caker: yes, I did, but I think I've realized my error...rebooting now
22:05<amitz>HoopyCat: if I get it right, I see some people with pin in the middle of tie without jacket.
22:05<HoopyCat>amitz: consider the differences amongst "ah, i crapped my pants!" "eh, i crapped my pants!" "hehe, i crapped my pants!" "hoho, i crapped my pants!"
22:06<amitz>HoopyCat: ah, I think I get what my problem is. I don't know how those words are supposedly pronounced. ah, is a as in ark right?
22:06-!-SNy [6863e8b699@bmx-chemnitz.de] has joined #linode
22:06*encode laughed aloud at HoopyCat's explanation
22:07-!-palintheus [trey@cqtopia.com] has quit [Ping timeout: 480 seconds]
22:07<@mikegrb>lolz
22:07<amitz>encode: that's an inefficient way to say lol :-p
22:07<sefz>sorry for the dumb question, what's the package to install crond?
22:07-!-azaghal [~azaghal@91.148.113.100] has quit [Ping timeout: 480 seconds]
22:07<@mikegrb>lolz
22:07<encode>amitz: yes, but most people typically write lol without having actually laughed
22:08<HoopyCat>amitz: i am about to fall asleep... catch me in a few days and i may dig up a microphone
22:08<amitz>oh sorry HoopyCat, later, nite!
22:08<HoopyCat>g'nite :-)
22:08<HoopyCat>encode <3
22:10-!-palintheus [trey@cqtopia.com] has joined #linode
22:12-!-seanscot [5c1db203@webchat.mibbit.com] has left #linode []
22:14-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has quit [Read error: Connection reset by peer]
22:15-!-walterheck [~walterhec@124.157.177.43] has quit [Ping timeout: 480 seconds]
22:16-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has joined #linode
22:17<sefz>Lost connection to MySQL server at 'reading initial communication packet', system error: 111
22:18-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
22:18-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has joined #linode
22:18-!-Sean [~4374f014@webuser.linode.com] has joined #linode
22:19<Sean>hey guys
22:19<Yaakov>HoopyCat
22:19<Yaakov>HOOPYCAT
22:19<Sean>Whats the best way to delete a 5gb single text file from my server?
22:19<bob2>the rm command
22:19<Bdragon>err, rm?
22:19<@mikegrb>lolz
22:19<Sean>uh whats that lol
22:19<bob2>what other way would you use?
22:19<Bdragon>man rm
22:20<Sean>so i just do "rm filename.txt"?
22:20-!-azaghal [~azaghal@195.252.105.111] has joined #linode
22:21-!-Twayne [~waynemilt@cpe-174-099-046-093.nc.res.rr.com] has quit [Ping timeout: 480 seconds]
22:21*amitz just realized, many 2 letters command line in linux is still available.
22:21<Bdragon>Assuming you are in the correct directory at the time, yes
22:21<Sean>sooo "cd ~/rightdirectory
22:21<Sean>then rm filename.txt
22:21-!-lakin [~lakin@S01060013101832cd.cg.shawcable.net] has joined #linode
22:22<Bdragon>Yes. I'm surprised you got this far without rm.
22:22<Bdragon>rm on unix = del on dos
22:22<@mikegrb>lolz
22:22<Sean>lol its actually a nohup output, but now im using screen
22:22-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
22:22<Bdragon>Are you trolling or what?
22:23*Bdragon likes using tee so he can still see what's going on :P
22:24<Sean>lmao that deleted the file so dam quick
22:24<bob2>are you really laughing that much?
22:24<Bdragon>well yeah, it's just an unlink call in the end...
22:24-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Ping timeout: 480 seconds]
22:24<Sean>i was about to SFTP and do it from there, it would have taken ages
22:24<Sean>anyways
22:24<Sean>thanks guys
22:25-!-Sean [~4374f014@webuser.linode.com] has left #linode []
22:25*Bdragon still can't tell if that was a very good troll or he seriously didn't know rm.... :-/
22:26<sefz>is there a linode iPhone app ?
22:27<Bdragon>I feel like the time I found out my dad didn't know what a shift key was (he'd never taken typing classes......)
22:27<Bdragon>sefz: There's several ssh clients, is that good enough? :P
22:28-!-Arutha [~arutha@ppp121-44-242-163.lns20.syd7.internode.on.net] has joined #linode
22:28-!-cmjb [~johnb@pool-71-244-156-218.chi.dsl-w.verizon.net] has quit [Ping timeout: 480 seconds]
22:29-!-sefz [~jessi@host108-108-dynamic.27-79-r.retail.telecomitalia.it] has quit [Quit: m1rk Xp]
22:37-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
22:42-!-borris84 [~Lars@rrcs-96-10-93-84.se.biz.rr.com] has quit [Read error: Connection reset by peer]
22:49-!-Edgeman [~edgeman@dyn216-8-168-143.ADSL.mnsi.net] has quit [Remote host closed the connection]
22:55-!-ubuntuisloved [~jason@cpe-74-67-36-120.nycap.res.rr.com] has quit [Ping timeout: 480 seconds]
22:55-!-Guest1717 is now known as meff
22:56-!-meff is now known as Guest1726
22:58-!-HIghoS [highos@highos.com] has quit [Ping timeout: 480 seconds]
22:59-!-cb [~cbrevard@ip68-0-147-162.tc.ph.cox.net] has joined #linode
22:59-!-cb is now known as Guest1727
23:02-!-chb [~cbrevard@ip24-251-236-201.ph.ph.cox.net] has quit [Ping timeout: 480 seconds]
23:02-!-Guest1727 is now known as chb
23:03-!-HIghoS [highos@highos.com] has joined #linode
23:04-!-Edgeman [~edgeman@dyn216-8-168-143.ADSL.mnsi.net] has joined #linode
23:09-!-karbassi [~karbassi@v-209-98-44-65.ip.visi.com] has joined #linode
23:11<kyhwana_>hrm
23:12<kyhwana_>anyone brought up xen+remus + linode yet?
23:12<amitz>kyhwana_: you often enter and exit this channel. What's the deal anyway? Bad connection?
23:12<dioz>what do you care?
23:13<kyhwana_>amitz: hm. Using v6, looks like oftc's only v6 server is in europe somewhere :(
23:14<amitz>kyhwana_: oh, I see. hmm, I'll just wait until the whole world migrates to ipv6 before I do :-p
23:14<kyhwana_>yeah well :P
23:14-!-dajhorn [~chatzilla@user-0cet72i.cable.mindspring.com] has quit [Ping timeout: 480 seconds]
23:14<kyhwana_>wouldn't ping out so much if all the other oftc servers had v6 too
23:15-!-borris [~Lars@rrcs-96-10-93-84.se.biz.rr.com] has joined #linode
23:15<@jed>kyhwana_: I read the paper, it's still really new
23:15<amitz>I use my linode to connect to OFTC server instead.
23:16<kyhwana_>jed: *nods* is it something you guys would look into at some point (maybe after it's matured a bit)
23:16<@jed>there's implementation details which make it mostly unusable for us
23:16<kyhwana_>oh, bummer
23:16<dioz>WHAT?
23:16<@jed>but I'm interested in its progress
23:16<dioz>oh shit
23:16<dioz>wrong term
23:16<@jed>it's not what it sounds like -- we'd essentially have to double our fleet and maintain a running copy of every linode to use it
23:17<@jed>one of the authors of the paper told me via e-mail about an hour ago that it has to run the entire time the domU is, so...it's cool, but we'll see
23:17<encode>so... where's the problem again?
23:17<@jed>I wouldn't expect it tomorrow
23:17<encode>:P
23:17<kyhwana_>jed: hmm, I was thinking you'd offer it as a premium service, etc
23:19<bd_>the paper sounds quite proud of the fact that the domU's not running on the backup, but it's still got all the same memory and disk needs, even if it's low-cpu
23:23-!-nard [~nard@CPE001ff33e804d-CM00159a68e808.cpe.net.cable.rogers.com] has joined #linode
23:28-!-blognewb [~blognewb@70.134.100.180] has joined #linode
23:31-!-lakin [~lakin@S01060013101832cd.cg.shawcable.net] has quit [Quit: Ex-Chat]
23:32-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit [Quit: Leaving]
23:33-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
23:37-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit []
23:38-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
23:42-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit []
23:44-!-dajhorn [~chatzilla@user-0cet72i.cable.mindspring.com] has joined #linode
23:48-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
23:48-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has joined #linode
23:48-!-Lymphocyte [421f74ac@webchat.mibbit.com] has joined #linode
23:49<Lymphocyte>Linux sucks
23:49<Trystan>yes.
23:49<brian>true
23:49<Lymphocyte>your all agreing?
23:49<brian>yup
23:49<Trystan>yep
23:49<Lymphocyte>fuck
23:49<Trystan>anything else we can help with?
23:49<Lymphocyte>I must adapt
23:49-!-Lymphocyte [421f74ac@webchat.mibbit.com] has left #linode []
23:49<Trystan>bad troll was bad.
23:50-!-silencewind [~silencewi@76-10-150-104.dsl.teksavvy.com] has joined #linode
23:50<brian>yup
23:50-!-PlasmaCell [421f74ac@webchat.mibbit.com] has joined #linode
23:50<PlasmaCell>yo
23:50-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
23:50<brian>you were just here
23:50<brian>you said linux sucks
23:50<PlasmaCell>I am a plasma cell who can shoot out up to 10000 Antibodys a second
23:51-!-silencewind [~silencewi@76-10-150-104.dsl.teksavvy.com] has quit []
23:51<brian>are you 12?
23:51<Trystan>PlasmaCell: that sounds rewarding
23:51<PlasmaCell>Tux is a pathogen and i am a unique Immune cell and i have a antibody for tux
23:52<brian>i liak turtals
23:52-!-awnstudio [~awnstudio@c-69-249-126-215.hsd1.pa.comcast.net] has quit [Read error: Connection reset by peer]
23:52<PlasmaCell>The antibody will make tux be engulfed easier by a macrophage and from there he will under go a process called "phagocytosis" inside the macrophage
23:52<bob2>PlasmaCell: try a car analogy instead
23:52-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has quit []
23:52<PlasmaCell>whats a car? I am only an immune system cell
23:53<amitz>de javu, you just trolled #debian a few weeks ago.
23:53<PlasmaCell>?
23:53<Trystan>did he succeed then?
23:53-!-PlasmaCell is now known as CytotoxicTCell
23:53<Trystan>cos.. well.. this is pretty fail
23:53<CytotoxicTCell>what?
23:53<brian>is this supposed to be upsetting
23:53<Trystan>seems to be amusing
23:54<Trystan>he cant fail that much to be able to make something intended to be upsetting amusing
23:54<opello>it's how griefers must start out in life
23:54<sullen> nice im chatting from my moto droid
23:54<CytotoxicTCell>i am a cytotoxic t cell and can destroy virus infected cells and cancer cells
23:54<brian>I really want a beer.
23:54<brian>Maybe two beers.
23:54<amitz>Trystan: well, (s)he was a great amusement :-)
23:54-!-kyhwana_ [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has quit [Remote host closed the connection]
23:54-!-kyhwana [~kyhwana@cl-3.wlg-01.nz.sixxs.net] has joined #linode
23:54<brian>amitz, GET ME BEER
23:54<amitz>until everybody just got bored.
23:55<Trystan>amitz: yea I can see why you would say that :)
23:55<CytotoxicTCell>COmmuter rail is better than driving
23:55-!-hpj [~hpj@40.89-10-30.nextgentel.com] has quit [Ping timeout: 480 seconds]
23:55<brian>Trystan, I can has beer?
23:55<Trystan>sure
23:55<Trystan>there in the fridge
23:55*amitz passes beer to brian.
23:55<Trystan>help yourself
23:55*brian purrs
23:55<CytotoxicTCell>COmmuter rail is better than driving
23:55<Trystan>it is!
23:55<Trystan>if more people took public transport it would help greatly
23:56<brian>public transport is for wimps
23:56<CytotoxicTCell>6.25$ one way to boston
23:56<CytotoxicTCell>Driving is for wimps
23:56<opello>wimps and populated areas
23:56-!-orudie_ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
23:56<CytotoxicTCell>its easier than fighting other people on the high way in rush hour
23:56<CytotoxicTCell>i dont have a license and i am 18
23:56<CytotoxicTCell>I could care less about driving
23:56<brian>I don'thave a license and I'm 21
23:56<CytotoxicTCell>I live right next to a train station
23:56<brian>do u have some kind of ponit
23:56<Trystan>i've driven since i was 12
23:56<brian>*point
23:56-!-Guest1726 is now known as meff
23:56<CytotoxicTCell>well near one
23:57<CytotoxicTCell>yes i do have a point
23:57-!-Paul__ [~Paul@ool-18bded42.dyn.optonline.net] has joined #linode
23:57<Nivex>I'm 29, have a drivers license, and take the bus to work every day.
23:57<Nivex>lack of road rage ftw
23:57<CytotoxicTCell>STOP DRIVING AND TAKE PUBLIC TRANSIT
23:57*jed watches, quietly
23:57-!-meff is now known as Guest1731
23:57<CytotoxicTCell>Sure the MBTA is a fucking piece of shit with all of its debt
23:57<Trystan>CytotoxicTCell: what about where it isnt avaliable?
23:57<CytotoxicTCell>thats different
23:58-!-cmjb [~johnb@cpe-75-180-13-215.columbus.res.rr.com] has quit [Ping timeout: 480 seconds]
23:58<brian>I named my penis Charlie.
23:58<Trystan>i named mine richard
23:58<brian>That name is so cliche.
23:58<path>i've started taking the bus this past summer and i like it much more than driving
23:59-!-VS_ChanLog [~stats@ns.theshore.net] has left #linode [Rotating Logs]
23:59<path>and i only like 3 miles away
23:59<path>live
23:59-!-VS_ChanLog [~stats@ns.theshore.net] has joined #linode
23:59<CytotoxicTCell>hmm
23:59<CytotoxicTCell>driving is gay
23:59<Trystan>from the bus? or from where you work?
23:59<path>by road, my house is 3 miles to work
23:59<Trystan>what about if you drive a bus/train?
23:59<CytotoxicTCell>all i have to do is walk 10 Mins to the train station and i am in boston in 39 Mins
---Logclosed Thu Nov 12 00:00:10 2009